Recombinant Full Length Shewanella Sp. Lipid A Export Atp-Binding/Permease Protein Msba(Msba) Protein, His-Tagged
Cat.No. : | RFL10688SF |
Product Overview : | Recombinant Full Length Shewanella sp. Lipid A export ATP-binding/permease protein MsbA(msbA) Protein (Q0HTS8) (1-601aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Shewanella sp. |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-601) |
Form : | Lyophilized powder |
AA Sequence : | MTASPKDEMWTVFKRLLGYLKPMKGMFLLSVCGLIVYGLVDAAFISFIGPFIDKGFSSST PAISNGIALPTSQGFHADNQVLLMAPIVVILMFSLRGFANFVSTYGISYMSARLIMDMRQ QVFEHYLSLPVSYMDKENTGNLISKVTFDTEQIARASGSALISIVRDGVTVIGMLGLMFY NSWKLSLCILVIGPIMGLVITIVSRRFRKVSKQIQTAMGDVSAATEQMIKGHKNVLAFGG QETETARFAKINDRNRHQNMKLAVAQAVSQPLIMVIGSFALAFVLYAASLDSMKADLTAG TFATILGAMMAMLQPIKNLTRVNAEFQRGIAACTTVFELLDTLPESDTGTYTVKRAKGNL RFDNVSFSYEGQERRALDKIDFEVTQGQTLALVGRSGSGKSTIASLVTRFYTGLESGDIK LDDVSIYDYSLKSLRSQVALVSQQVTLFNDTIANNIAYAYPGEATREQIIQAATLAHAME FIEQLPEGLDTQVGENGVLLSGGQRQRIAIARAMLRDAPVLILDEATSALDTESEKAIQQ GLDNLRQNRTSVVIAHRLSTIESADQILVVDQGRIVERGTHKSLLELGGMYAKLYQMQFG S |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | msbA |
Synonyms | msbA; Shewmr7_2492; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA |
UniProt ID | Q0HTS8 |
◆ Recombinant Proteins | ||
RFL14397SF | Recombinant Full Length Staphylococcus Aureus Putative Antiporter Subunit Mnhg2(Mnhg2) Protein, His-Tagged | +Inquiry |
P-6/P-7-5979C | Recombinant Chlamydia trachomatis P-6/P-7 protein, His-tagged | +Inquiry |
EEF2-5083HFL | Recombinant Full Length Human EEF2, Flag-tagged | +Inquiry |
IFNA4-75H | Recombinant Human Interferon, Alpha 4 | +Inquiry |
TMEM242-4211H | Recombinant Human TMEM242 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
Complement C3c-49H | Native Human Complement C3c | +Inquiry |
Collagen-322H | Native Human Collagen IV | +Inquiry |
PGA-130H | Active Native Human Pepsinogen I | +Inquiry |
Trypsin-265H | Native Human Trypsin | +Inquiry |
Streptavidin-24 | Streptavidin | +Inquiry |
◆ Cell & Tissue Lysates | ||
CRHR2-399HCL | Recombinant Human CRHR2 cell lysate | +Inquiry |
CLTA-7429HCL | Recombinant Human CLTA 293 Cell Lysate | +Inquiry |
A431-156H | A431 Whole Cell Lysate (Human Epidermoid Carcinoma) | +Inquiry |
BATF3-1656HCL | Recombinant Human BATF3 cell lysate | +Inquiry |
IL1RAPL2-2165HCL | Recombinant Human IL1RAPL2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All msbA Products
Required fields are marked with *
My Review for All msbA Products
Required fields are marked with *
0
Inquiry Basket