Recombinant Full Length Pseudoalteromonas Haloplanktis Lipid A Export Atp-Binding/Permease Protein Msba(Msba) Protein, His-Tagged
Cat.No. : | RFL34798PF |
Product Overview : | Recombinant Full Length Pseudoalteromonas haloplanktis Lipid A export ATP-binding/permease protein MsbA(msbA) Protein (Q3IGX5) (1-581aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pseudoalteromonas haloplanktis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-581) |
Form : | Lyophilized powder |
AA Sequence : | MDQSTTQIYKRLISYVGAYRTVAIVAIIGMIGYSGMDALFIQLMKPFIDEGLNERNADVL KYAPFVVIALVIGRGVFNFMSSYCLSYVGSQVVRSLRQELFEHILHLPVSFHDKNSTGDL ISKITFDTEQVQQAITKALLIVVREGAFVVFLLAVMFYTSWQLSLIFLVIIPLVAVIVTV VSKRFRHISKSIQSAMGQVTRSSEQMLSGHKVIHGFGGQNQEIDQFSKVNNHNRQQRIKM DATKALSVSIIQVLAASAMAVILWVVSMPSMIDTISSGDFVVLISSMMMLLRPLKQLANV NSDMQRGVSAAQSVFLILDEEVEKDTGTVSVDKVKGLIEVKNVTFKYPTKDEPVLNNLSL TIKAGESIALVGRSGSGKSTISNLLPRYYDLEAPSEILLDGIALHDYKLTDLRRQFALVS QQVVLFNDSIANNICYGLQREISQQELEKVAKQAHVWEFVKDLPEQLNTMVGENGVMLSG GQRQRIAIARAILKDAPILILDEATSALDTESEKLIQQALEALMKDKTSIVIAHRLSTIE NSDRIYVIDNGSVIESGDHLSLLANNGTYSALCKMQFGEQG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | msbA |
Synonyms | msbA; PSHAa1661; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA |
UniProt ID | Q3IGX5 |
◆ Native Proteins | ||
C3-08R | Native Rat C3 Protein | +Inquiry |
LN-2686M | Native Mouse LN Protein | +Inquiry |
Hld-730S | Active Native S. aureus delta Hemolysin Protein | +Inquiry |
AMY1B-31376TH | Native Human AMY1B | +Inquiry |
ABL1-618H | Native Human C-abl Oncogene 1, Receptor Tyrosine Kinase | +Inquiry |
◆ Cell & Tissue Lysates | ||
MAN1A1-1049HCL | Recombinant Human MAN1A1 cell lysate | +Inquiry |
ZNF593-40HCL | Recombinant Human ZNF593 293 Cell Lysate | +Inquiry |
MGLL-4331HCL | Recombinant Human MGLL 293 Cell Lysate | +Inquiry |
FAM81B-6347HCL | Recombinant Human FAM81B 293 Cell Lysate | +Inquiry |
ZNF565-2054HCL | Recombinant Human ZNF565 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All msbA Products
Required fields are marked with *
My Review for All msbA Products
Required fields are marked with *
0
Inquiry Basket