Recombinant Full Length Haemophilus Influenzae Lipid A Export Atp-Binding/Permease Protein Msba(Msba) Protein, His-Tagged
Cat.No. : | RFL11820HF |
Product Overview : | Recombinant Full Length Haemophilus influenzae Lipid A export ATP-binding/permease protein MsbA(msbA) Protein (Q4QPI4) (1-587aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Haemophilus Influenzae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-587) |
Form : | Lyophilized powder |
AA Sequence : | MQEQKLQENDFSTLQTFKRLWPMIKPFKAGLIASGIALVFNALADSGLIYLLKPLLDDGF GKANHSFLKIMAFVVVGMIILRGVTNFISNYCLAWVSGKVVMTMRRRLFKHLMFMPVSFF DRNSTGKLLSRITYDSEMIASSSSGSLITIVREGAYIISLLAVMFYTSWELTLVLFVIGP IIAVLITIVSKIFRKLSKNLQDSMGELTATTEQMLKGHKVVISFGGQFVEEERFNKVSNN MRRKGMKMVTADSISDPVVQIIASLALVAVLFLATTPLIAEDNLSAGSFTVVFSSMLAMM RPLKSLTNVNSQFQRGMAACQTLFAILDLEPEKDNGTYKAEPAKGALEFKNVSFAYQGKE ELALNNISFSVPAGKTVALVGRSGSGKSTIANLVTRFYDIEQGEILLDGVNIQDYRLSNL RENCAVVSQQVHLFNDTIANNIAYAAQDKYSREEIIAAAKAAYALEFIEKLPQGFDTVIG ENGASLSGGQRQRLAIARALLRNSPVLILDEATSALDTESERAIQSALDELKKDRTVIVI AHRLSTIENADEILVIDHGEIRERGNHKALLEQNGAYKQLYSMQFSG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | msbA |
Synonyms | msbA; NTHI0072; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA |
UniProt ID | Q4QPI4 |
◆ Recombinant Proteins | ||
IL3-120H | Active Recombinant Human Interleukin 3 (Colony-stimulating Factor, Multiple) | +Inquiry |
ZNF451-5145R | Recombinant Rhesus Macaque ZNF451 Protein, His (Fc)-Avi-tagged | +Inquiry |
CDH11-0971H | Recombinant Human CDH11 Protein, His-Flag-StrepII-Tagged | +Inquiry |
GNG11-3770M | Recombinant Mouse GNG11 Protein, His (Fc)-Avi-tagged | +Inquiry |
ANXA9-5262H | Recombinant Human ANXA9 protein, His/GST-tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1859W | Active Native Wheat Germ Agglutinin Protein, Agarose bound | +Inquiry |
Cry1Ac-524 | Native Bacillus thuringiensis Cry1Ac Protein | +Inquiry |
LDHA-26867TH | Native Human LDHA | +Inquiry |
Lectin-1750M | Active Native Maackia Amurensis Lectin II Protein | +Inquiry |
NADS-33 | Active Native NAD synthase | +Inquiry |
◆ Cell & Tissue Lysates | ||
HDAC8-691HCL | Recombinant Human HDAC8 cell lysate | +Inquiry |
ETFA-6532HCL | Recombinant Human ETFA 293 Cell Lysate | +Inquiry |
MND1-678HCL | Recombinant Human MND1 cell lysate | +Inquiry |
ADAMTS18-26HCL | Recombinant Human ADAMTS18 cell lysate | +Inquiry |
THBS2-1100HCL | Recombinant Human THBS2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All msbA Products
Required fields are marked with *
My Review for All msbA Products
Required fields are marked with *
0
Inquiry Basket