Recombinant Full Length Shigella Dysenteriae Serotype 1 Lipid A Export Atp-Binding/Permease Protein Msba(Msba) Protein, His-Tagged
Cat.No. : | RFL36605SF |
Product Overview : | Recombinant Full Length Shigella dysenteriae serotype 1 Lipid A export ATP-binding/permease protein MsbA(msbA) Protein (Q32E34) (1-582aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Shigella Dysenteriae Serotype 1 |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-582) |
Form : | Lyophilized powder |
AA Sequence : | MHNDKDLSTWQTFRRLWPTIAPFKAGLIVAGVALILNAASDTFMLSLLKPLLDDGFGKTD RSVLVWMPLVVIGLMILRGITSYVSSYCISWVSGKVVMTMRRRLFGHMMGMPVSFFDKQS TGTLLSRITYDSEQVASSSSGALITVVREGASIIGLFIMMFYYSWQLSIILIVLAPIVSI AIRVVSKRFRNISKNMQNTMGQVTTSAEQMLKGHKEVLIFGGQEVETKRFDKVSNRMRLQ GMKMVSASSISDPIIQLIASLALAFVLYAASFPSVMDSLTAGTITVVFSSMIALMRPLKS LTNVNAQFQRGMAACQTLFTILDSEQEKDEGKRVIERATGDVEFRNVTFTYPGRDVPALR NINLKIPAGKTVALVGRSGSGKSTIASLITRFYDIDEGEILMDGHDLREYTLASLRNQVA LVSQNVHLFNDTVANNIAYARTEQYSREQIEEAARMAYAMDFINKMDNGLDTVIGENGVL LSGGQRQRIAIARALLRDSPILILDEATSALDTESERAIQAALDELQKNRTSLVIAHRLS TIEKADEIVVVEDGVIVERGTHNDLLEHRGVYAQLHKMQFGQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | msbA |
Synonyms | msbA; SDY_2344; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA |
UniProt ID | Q32E34 |
◆ Recombinant Proteins | ||
ACYP2-277H | Recombinant Human ACYP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
ZNF596-356H | Recombinant Human ZNF596 Protein, His-tagged | +Inquiry |
NKIRAS2-1087H | Recombinant Human NKIRAS2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
FUNDC1-813Z | Recombinant Zebrafish FUNDC1 | +Inquiry |
SAP050A-032-4073S | Recombinant Staphylococcus aureus (strain: NE 3874) SAP050A_032 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
OXT-5360H | Native Human Oxytocin, Prepropeptide | +Inquiry |
FG-164B | Native Bovine fibrinogen degradation products | +Inquiry |
CTSB-5328H | Native Human Cathepsin B | +Inquiry |
Apotransferrin-38R | Native Rat Apotransferrin | +Inquiry |
HPX-29307TH | Native Human HPX | +Inquiry |
◆ Cell & Tissue Lysates | ||
KRTAP23-1-4843HCL | Recombinant Human KRTAP23 293 Cell Lysate | +Inquiry |
PIAS2-3203HCL | Recombinant Human PIAS2 293 Cell Lysate | +Inquiry |
GPR63-5780HCL | Recombinant Human GPR63 293 Cell Lysate | +Inquiry |
DDX55-7002HCL | Recombinant Human DDX55 293 Cell Lysate | +Inquiry |
POLR2C-3036HCL | Recombinant Human POLR2C 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All msbA Products
Required fields are marked with *
My Review for All msbA Products
Required fields are marked with *
0
Inquiry Basket