Recombinant Full Length Dechloromonas Aromatica Lipid A Export Atp-Binding/Permease Protein Msba(Msba) Protein, His-Tagged
Cat.No. : | RFL10597DF |
Product Overview : | Recombinant Full Length Dechloromonas aromatica Lipid A export ATP-binding/permease protein MsbA(msbA) Protein (Q47JR8) (1-585aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Dechloromonas aromatica |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-585) |
Form : | Lyophilized powder |
AA Sequence : | MSHDMTSRELYLRLLTYVRPYWKAFLAALACMGVASLAEPVFPAIMKSLLDDGFSKANGP WDWLFYPLAIMGIFLVRAIFGFLGDYLMSWVSNNVVAELRQAMFARMVRLPTRYYSDNLS GRLMSRIAYDVTGVAGAATNALTSLIKDSLSIVGLLVWLLWLNWQLTLITLSVVPFIAIV VRVFSKRLRSVARGQQESMGKITQVLQEAIEGHKVVKIFGGQSYEEDRFYESIREQRRLA MRATLASAAQSPLVQFFAASGVAIIMGVALKQASSDQTTVGSFVSFVTAMLMLMAPLKRV TDVNAPIQRGLAAAESVFSLVDEETEPDSGKEELGRAQGLVEFDGVTFTYPGSERPALDS VSLTVRPGECVALVGPSGSGKTTAANLLPRFYALDAGEIRVDGHALPNIRLNSLRDNIAL VSQDVVLFNDTIGANIAYGGKRDATLDEIRAAAKAAHALEFIDALPEGLNTMIGENGVKL SGGQRQRLAIARAILKDAPILILDEATSALDTESERHVQAALDELMRGRSTLVIAHRLST IERADRIIALAHGHKQEEGSHAELLAHDGLYARLYRMQKAEEVAV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | msbA |
Synonyms | msbA; Daro_0154; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA |
UniProt ID | Q47JR8 |
◆ Recombinant Proteins | ||
CDK5-4483H | Recombinant Human CDK5 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RFL32570GF | Recombinant Full Length Grapevine Fleck Virus Uncharacterized Protein Orf3(Orf3) Protein, His-Tagged | +Inquiry |
PANK1-34H | Recombinant Human PANK1 Protein, GST-tagged | +Inquiry |
TRIM28-2325H | Recombinant Human TRIM28, His-tagged | +Inquiry |
PSMD6-6716H | Recombinant Human PSMD6 Protein (Met1-Met389), N-GST tagged | +Inquiry |
◆ Native Proteins | ||
Testosterone-01H | Native Human Testosterone | +Inquiry |
Lectin-1843S | Active Native Solanum Tuberosum Lectin Protein, Fluorescein labeled | +Inquiry |
Avidin-015 | Native Avidin Protein, Peroxidase conjugated | +Inquiry |
Lectin-1808M | Active Native Maackia Amurensis Lectin I Protein, Fluorescein labeled | +Inquiry |
IgG-018R | Native Rabbit Whole Molecule IgG, Biotin-LC-NHS Conjugated | +Inquiry |
◆ Cell & Tissue Lysates | ||
CerebralCortex-556M | MiniPig Cerebral Cortex Lysate, Total Protein | +Inquiry |
GNG2-5853HCL | Recombinant Human GNG2 293 Cell Lysate | +Inquiry |
CLPP-7434HCL | Recombinant Human CLPP 293 Cell Lysate | +Inquiry |
SERPINH1-1936HCL | Recombinant Human SERPINH1 293 Cell Lysate | +Inquiry |
PLA2G1B-2200HCL | Recombinant Human PLA2G1B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All msbA Products
Required fields are marked with *
My Review for All msbA Products
Required fields are marked with *
0
Inquiry Basket