Recombinant Full Length Emericella Nidulans Formation Of Crista Junctions Protein 1(Fcj1) Protein, His-Tagged
Cat.No. : | RFL2644EF |
Product Overview : | Recombinant Full Length Emericella nidulans Formation of crista junctions protein 1(fcj1) Protein (Q5B6I7) (42-618aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Emericella nidulans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (42-618) |
Form : | Lyophilized powder |
AA Sequence : | ADAKSPTPVTPSSATPVPAETAAKSTAGPSATETPTPAPTRKTGRFRKFLIYLILTSGLA YGGGVFLALKSDNFHDFFTEYVPYGEESVLYFEERDFYRRFPNTLRNKNRLSPASRDEGS RVTIPSKSGLSSKEVEETGTDVSQPGPHMSAVTPAKADEATIKPAAAKPEEKTAAVKEAK KQAQEPEKPREEPKQEPKLPGSAPITTLEFANVSEGDEPIVQELVKTFNDIITVISADED SAKYSKPVAKAKEELQKIGEQILSVRDEARRAAQEEIEKAHATFDESARELIRRFEEVRA NDAAQYREEFEAERERLALAYQQKIQTELQRAQEIAEQRLQNELVEQAIELNRKYIHEVK DLVEREREGRLSKLSELTSSVSELETLVTGWREVIDTNLKTQQLQVAVDAVRSALERSTV PRPFVRELVAVKELAGDDPVVEAAIASINPAAYQRGIPSTSQIIERFRRVADEVRKASLL PEDAGIASHAASLVLSKVMFKKDAEAGSDDVESVLLRTENLLEQGNLDDAAREMNSLKGW AKILSKDWLADVRRVLEVKQALEVIETEARLQCLRVE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | mic60 |
Synonyms | mic60; AN3843; MICOS complex subunit mic60; Mitofilin |
UniProt ID | Q5B6I7 |
◆ Native Proteins | ||
Spinal cord-C57M | Mouse Spinal cord whole Lysate, Total Protein | +Inquiry |
Rectum-024H | Human Rectum Lysate, Total Protein | +Inquiry |
Lectin-1779G | Active Native Griffonia Simplicifolia Lectin I Protein, Biotinylated | +Inquiry |
FABP1-509H | Native Human FABP1 | +Inquiry |
C3-08R | Native Rat C3 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
USP45-453HCL | Recombinant Human USP45 293 Cell Lysate | +Inquiry |
PRAME-2896HCL | Recombinant Human PRAME 293 Cell Lysate | +Inquiry |
ADIPOR2-9009HCL | Recombinant Human ADIPOR2 293 Cell Lysate | +Inquiry |
ARSH-133HCL | Recombinant Human ARSH cell lysate | +Inquiry |
ALCAM-1098CCL | Recombinant Cynomolgus ALCAM cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All mic60 Products
Required fields are marked with *
My Review for All mic60 Products
Required fields are marked with *
0
Inquiry Basket