Recombinant Full Length Candida Albicans Formation Of Crista Junctions Protein 1(Fcj1) Protein, His-Tagged
Cat.No. : | RFL15219CF |
Product Overview : | Recombinant Full Length Candida albicans Formation of crista junctions protein 1(FCJ1) Protein (C4YLH0) (26-565aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Candida albicans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (26-565) |
Form : | Lyophilized powder |
AA Sequence : | NIAPKVVSPPVPPPVKPQGSEIPPPPPPPPLKAKRFSLFGFLFKTTLLATVVYGGTLYAA TKNDKVMDFVIDKQLPFHEELIDLIENGSTEDLQEAWEQLKNKFTDVKLPTKDDIDELTQ KLEHRGEDIIKETKKKIASTHIGHKSGTDLTPTEQLQRGVEIESVKKDVAHLPLIELNSD LGKSVDETVKQTITSFNNFIQSIDASSLATKDDKLITSINTSVNQLASRLNSLTKDFDNE LQNKLKVSQTELFSSFTKKELELTENLLHQFSTEKQQLEAKLNQKLSQEIQAARAAISQA ASNAVAMVRIEQTKNFEKLVSEKLNEERNGRLANLEKLNDRIVELEKFAEGFETQIVSNH KKAIIHQAVSKLKSLLLAPAAGDKPQPIKPYIDELTKIATDDEVLALAIKDLSPLITNES THSILTNAQLLSRWEQLAPELRSASLLPPNAGLLGHLASIVFSKLLLPVKGVKEDGKDIE SVIGRVESSLARGELDIAVEEAANLKGWSRKLANDWVVEGRKRLEIEFLLGLIESESKII |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MIC60 |
Synonyms | MIC60; CAWG_01688; MICOS complex subunit MIC60; Mitofilin |
UniProt ID | C4YLH0 |
◆ Recombinant Proteins | ||
G-1514H | Recombinant HRSV (A, strain Long) G protein, His-tagged | +Inquiry |
KREMEN2-3244H | Recombinant Human KREMEN2 Protein, His (Fc)-Avi-tagged | +Inquiry |
MLKL-0926H | Recombinant Human MLKL Protein (E2-K471), His/GST tagged | +Inquiry |
RFL26331EF | Recombinant Full Length Glutamate/Aspartate Transport System Permease Protein Gltj(Gltj) Protein, His-Tagged | +Inquiry |
RANBP2-13912M | Recombinant Mouse RANBP2 Protein | +Inquiry |
◆ Native Proteins | ||
gG2-650V | Native Herpes Simplex Virus gG2 Protein | +Inquiry |
Collagen type I-01H | Native Human Collagen type I Protein | +Inquiry |
Collagen Type I & III-05C | Native Canine Collagen Type I and III Protein | +Inquiry |
PRF1-55H | Native Human Perforin | +Inquiry |
CTSB-26408TH | Native Human CTSB | +Inquiry |
◆ Cell & Tissue Lysates | ||
TXNL1-619HCL | Recombinant Human TXNL1 293 Cell Lysate | +Inquiry |
CDCA5-7641HCL | Recombinant Human CDCA5 293 Cell Lysate | +Inquiry |
TEX101-1143HCL | Recombinant Human TEX101 293 Cell Lysate | +Inquiry |
SOX8-1673M | Sol8 (mouse myoblast) whole cell lysate | +Inquiry |
DACT1-7084HCL | Recombinant Human DACT1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MIC60 Products
Required fields are marked with *
My Review for All MIC60 Products
Required fields are marked with *
0
Inquiry Basket