Recombinant Full Length Elastin-Binding Protein Ebps(Ebps) Protein, His-Tagged
Cat.No. : | RFL18287SF |
Product Overview : | Recombinant Full Length Elastin-binding protein ebpS(ebpS) Protein (Q53630) (2-486aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus aureus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (2-486) |
Form : | Lyophilized powder |
AA Sequence : | SNNFKDDFEKNRQSIDTNSHQDHTEDVEKDQSELEHQDTIENTEQQFPPRNAQRRKRRRD LATNHNKQVHNESQTSEDNVQNEAGTIDDRQVESSHSTESQEPSHQDSTPQHEEGYYNKN AFAMDKSHPEPIEDNDKHETIKEAENNTEHSTVSDKSEAEQSQQPKPYFATGANQANTSK DKHDDVTVKQDKDESKDHHSGKKGAAIGAGTAGVAGAAGAMGVSKAKKHSNDAQNKSNSG KVNNSTEDKASEDKSKEHHNGKKGAAIGAGTAGLAGGAASNSASAASKPHASNNASQNND EHDHHDRDKERKKGGMAKVLLPLIAAVLIIGALAIFGGMALNNHNNGTKENKIANTNKNN ADESKDKDTSKDASKDKSKSTDSDKSKDDQDKATKDESDNDQNNANQANNQAQNNQNQQQ ANQNQQQQQQRQGGGQRHTVNGQENLYRIAIQYYGSGSPENVEKIRRANGLSGNNIRNGQ QIVIP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ebpS |
Synonyms | ebpS; Elastin-binding protein EbpS |
UniProt ID | Q53630 |
◆ Recombinant Proteins | ||
AANAT-0509H | Recombinant Human AANAT Protein (Met1-Cys207), N-His-tagged | +Inquiry |
RFL28240NF | Recombinant Full Length Neorickettsia Risticii Atp-Dependent Zinc Metalloprotease Ftsh(Ftsh) Protein, His-Tagged | +Inquiry |
TLR4-29825TH | Recombinant Human TLR4 | +Inquiry |
GLYR1-3042H | Recombinant Human GLYR1 Protein, His (Fc)-Avi-tagged | +Inquiry |
TRIM28-053H | Recombinant Human TRIM28 Mutant (K779R) Protein, Myc/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1870W | Active Native Wisteria Floribunda Lectin Protein, Fluorescein labeled | +Inquiry |
Tryptase-61H | Native Human Mast Cell Tryptase | +Inquiry |
VTN -61R | Native Rabbit multimeric vitronectin | +Inquiry |
IgA-244H | Native Horse Immunoglobulin A | +Inquiry |
CDA015 | Native Hepatitis B Surface Ag protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
Kidney-668H | Hamster Kidney Lysate, Total Protein | +Inquiry |
MEA1-4398HCL | Recombinant Human MEA1 293 Cell Lysate | +Inquiry |
LMAN1-4719HCL | Recombinant Human LMAN1 293 Cell Lysate | +Inquiry |
MLPH-4289HCL | Recombinant Human MLPH 293 Cell Lysate | +Inquiry |
CDK1-001MCL | Recombinant Mouse CDK1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All ebpS Products
Required fields are marked with *
My Review for All ebpS Products
Required fields are marked with *
0
Inquiry Basket