Recombinant Full Length Staphylococcus Aureus Elastin-Binding Protein Ebps(Ebps) Protein, His-Tagged
Cat.No. : | RFL29924SF |
Product Overview : | Recombinant Full Length Staphylococcus aureus Elastin-binding protein ebpS(ebpS) Protein (A6QH29) (2-486aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus aureus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (2-486) |
Form : | Lyophilized powder |
AA Sequence : | SNNFKDDFEKNRQSIDTNSHQDHTEDVEKDQSELEHQDTIENTEQQFPPRNAQRRKRRRD LATNHNKQVHNESQTSEDNVQNEAGTIDDRQVESSHSTESQEPSHQDSTPQHEEEYYNKN AFAMDKSHPEPIEDNDKHDTIKNAENNTEHSTVSDKSEAEQSQQPKPYFTTGANQSETSK NEHDNDSVKQDQDEPKEHHNGKKAAAIGAGTAGVAGAAGAMAASKAKKHSNDAQNKSNSG KANNSTEDKASQDKSKDHHNGKKGAAIGAGTAGLAGGAASKSASAASKPHASNNASQNHD EHDNHDRDKERKKGGMAKVLLPLIAAVLIIGALAIFGGMALNNHNNGTKENKIANTNKNN ADESKDKDTSKDASKDKSKSTDSDKSKEDQDKATKDESDNDQNNANQANNQAQNNQNQQQ ANQNQQQQQQRQGGGQRHTVNGQENLYRIAIQYYGSGSPENVEKIRRANGLSGNNIRNGQ QIVIP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ebpS |
Synonyms | ebpS; NWMN_1389; Elastin-binding protein EbpS |
UniProt ID | A6QH29 |
◆ Recombinant Proteins | ||
Thyn1-6422M | Recombinant Mouse Thyn1 Protein, Myc/DDK-tagged | +Inquiry |
RFL10374XF | Recombinant Full Length Xanthomonas Axonopodis Pv. Citri Upf0761 Membrane Protein Xac0937(Xac0937) Protein, His-Tagged | +Inquiry |
TP53BP1-26025TH | Recombinant Human TP53BP1, His-tagged | +Inquiry |
EEF1G-4222C | Recombinant Chicken EEF1G | +Inquiry |
HSD17B7-5074H | Recombinant Human HSD17B7 Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
ICDH-209S | Active Native Swine Isocitrate Dehydrogenase | +Inquiry |
SERPINC1-8032H | Native Human Plasma AntiThromblin III | +Inquiry |
F12-28805TH | Native Human F12 | +Inquiry |
F2-5285H | Native Human Coagulation Factor II (thrombin) | +Inquiry |
CA19-9-01H | Active Native Human CA19-9 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL22-5232HCL | Recombinant Human IL22 293 Cell Lysate | +Inquiry |
BLMH-8445HCL | Recombinant Human BLMH 293 Cell Lysate | +Inquiry |
NFAM1-3860HCL | Recombinant Human NFAM1 293 Cell Lysate | +Inquiry |
ARHGEF25-5962HCL | Recombinant Human GEFT 293 Cell Lysate | +Inquiry |
SRPK3-566HCL | Recombinant Human SRPK3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All ebpS Products
Required fields are marked with *
My Review for All ebpS Products
Required fields are marked with *
0
Inquiry Basket