Recombinant Full Length Staphylococcus Aureus Elastin-Binding Protein Ebps(Ebps) Protein, His-Tagged
Cat.No. : | RFL15698SF |
Product Overview : | Recombinant Full Length Staphylococcus aureus Elastin-binding protein ebpS(ebpS) Protein (Q5HFU2) (2-486aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus aureus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (2-486) |
Form : | Lyophilized powder |
AA Sequence : | SNNFKDDFEKNRQSIDTNSHQDHTEDVEKDQSELEHQDTIENTEQQFPPRNAQRRKRRRD LATNHNKQVHNESQTSEDNVQNEAGTIDDRQVESSHSTESQEPSHQDSTPQHEEEYYNKN AFAMDKSHPEPIEDNDKHDTIKNAENNTEHSTVSDKSEAEQSQQPKPYFTTGANQSETSK NEHDNDSVKQDQDEPKEHHNGKKAAAIGAGTAGVAGAAGAMAASKAKKHSNDAQNKSNSG KANNSTEDKASQDKSKDHHNGKKGAAIGAGTAGLAGGAASKSASAASKPHASNNASQNHD EHDNHDRDKERKKGGMAKVLLPLIAAVLIIGALAIFGGMALNNHNNGTKENKIANTNKNN ADESKDKDTSKDASKDKSKSTDSDKSKEDQDKATKDESDNDQNNANQANNQAQNNQNQQQ ANQNQQQQQQRQGGGQRHTVNGQENLYRIAIQYYGSGSPENVEKIRRANGLSGNNIRNGQ QIVIP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ebpS |
Synonyms | ebpS; SACOL1522; Elastin-binding protein EbpS |
UniProt ID | Q5HFU2 |
◆ Recombinant Proteins | ||
DET1-2339M | Recombinant Mouse DET1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ALDH1B1-5002H | Recombinant Human ALDH1B1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
FBXO32-1952R | Recombinant Rat FBXO32 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL27568VF | Recombinant Full Length Vibrio Vulnificus Upf0208 Membrane Protein Vv2132(Vv2132) Protein, His-Tagged | +Inquiry |
PPP1R14AB-11066Z | Recombinant Zebrafish PPP1R14AB | +Inquiry |
◆ Native Proteins | ||
Lectin-1788G | Active Native Griffonia Simplicifolia Lectin II Protein, Biotinylated | +Inquiry |
APOC1-27330TH | Native Human APOC1 | +Inquiry |
RNase-43B | Active Native Bovine Ribonuclease | +Inquiry |
APOC1-8038H | Native Human ApoLipoprotein CI | +Inquiry |
LDH1-18H | Native Human Lactate Dehydrogenase 1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
CRAT-7293HCL | Recombinant Human CRAT 293 Cell Lysate | +Inquiry |
RBPMS-2451HCL | Recombinant Human RBPMS 293 Cell Lysate | +Inquiry |
Fetal Esophagus-140H | Human Fetal Esophagus Lysate | +Inquiry |
ATP4A-8608HCL | Recombinant Human ATP4A 293 Cell Lysate | +Inquiry |
KDSR-356HCL | Recombinant Human KDSR lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ebpS Products
Required fields are marked with *
My Review for All ebpS Products
Required fields are marked with *
0
Inquiry Basket