Recombinant Full Length Staphylococcus Aureus Elastin-Binding Protein Ebps(Ebps) Protein, His-Tagged
Cat.No. : | RFL20271SF |
Product Overview : | Recombinant Full Length Staphylococcus aureus Elastin-binding protein ebpS(ebpS) Protein (Q7A5I6) (2-486aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus aureus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (2-486) |
Form : | Lyophilized powder |
AA Sequence : | SNNFKDDFEKNRQSIDTNSHQDHTEDVEKDQSELEHQDTIENTEQQFPPRNAQRRKRRRD LATNHNKQVHNESQTSEDNVQNEAGTIDDRQVESSHSTESQEPSHQDSTPQHEEEYYNKN AFAMDKSHPEPIEDNDKHETIKDAENNTEHSTVSDKSIAEQSQQPKPYFATGANQANTSK DKHDDVTVKQDKDESKDHHSGKKGAAIGAGTAGVAGAAGAMGVSKAKKHSNDAQNKSNSD KSNNSTEDKASQDKSKDHHNGKKGAAIGAGTAGLAGGAASKSASAASKPHASNNASQNHD EHDNHDRDKERKKGGMAKVLLPLIAAVLIIGALAIFGGMALNNHNNGTKENKIANTNKNN ADESKDKDTSKDASKDKSKSTDSDKSKEDQDKATKDESDNDQNNANQANNQAQNNQNQQQ ANQNQQQQQQRQGGGQRHTVNGQENLYRIAIQYYGSGSPENVEKIRRANGLSGNNIRNGQ QIVIP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ebpS |
Synonyms | ebpS; SA1312; Elastin-binding protein EbpS |
UniProt ID | Q7A5I6 |
◆ Recombinant Proteins | ||
PON2-1153HFL | Recombinant Full Length Human PON2 Protein, C-Flag-tagged | +Inquiry |
MBD2-5643H | Recombinant Human MBD2 protein, hFc-tagged | +Inquiry |
SOX9-6261HF | Recombinant Full Length Human SOX9 Protein, GST-tagged | +Inquiry |
Apoc1-2353M | Recombinant Mouse Apoc1 protein, His-tagged | +Inquiry |
Adm-545M | Recombinant Mouse Adm Protein, MYC/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
lalp-237H | Active Native Human Inter Alpha Inhibitor Proteins (IaIp) | +Inquiry |
Fibrinogen-01S | Native Atlantic salmon Fibrinogen | +Inquiry |
IGHG1-617H | Native Human Immunoglobulin Heavy Constant Gamma 1 (G1m marker) | +Inquiry |
IgG-117P | Native Porcine Immunoglobulin G | +Inquiry |
ADIPOQ-215H | Native Human Adiponectin | +Inquiry |
◆ Cell & Tissue Lysates | ||
TUBA1A-662HCL | Recombinant Human TUBA1A 293 Cell Lysate | +Inquiry |
DUOXA1-1197HCL | Recombinant Human DUOXA1 cell lysate | +Inquiry |
FGFR3-001CCL | Recombinant Cynomolgus FGFR3 cell lysate | +Inquiry |
TRIM68-763HCL | Recombinant Human TRIM68 293 Cell Lysate | +Inquiry |
WNT6-290HCL | Recombinant Human WNT6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ebpS Products
Required fields are marked with *
My Review for All ebpS Products
Required fields are marked with *
0
Inquiry Basket