Recombinant Full Length Staphylococcus Aureus Elastin-Binding Protein Ebps(Ebps) Protein, His-Tagged
Cat.No. : | RFL23262SF |
Product Overview : | Recombinant Full Length Staphylococcus aureus Elastin-binding protein ebpS(ebpS) Protein (Q6G983) (2-486aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus aureus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (2-486) |
Form : | Lyophilized powder |
AA Sequence : | SNNFKDDFEKNRQSIDTNSHQDHTEDVEKDQSELEHQDTIENTEQQFPPRNAQRRKRRRD LATNHNKQVHNESQTSEDNVQNEAGTIDDRQVESSHSTESQEPSHQDSTPQHEEEYYNKN AFAMDKSHPEPIEDNDKHETIKEAENNTEHSTVSDKSEAEQSQQPKPYFATGANQANTSK DKHDDVTVKQDKDESKDHHSGKKGAAIGAGTAGVAGAAGAMGVSKAKKHSNDAQNKSNSD KSNNSTEDKVSQDKSKDHHNGKKGAAIGAGTAGLAGGAASKSASAASKPHASNNASQNHD EHDNHDRDKERKKGGMAKVLLPLIAAVLIIGALAIFGGMALNNHNNGTKENKIANTNKNN ADESKDKDTSKDASKDKSKSTDSDKSKEDQDKATKDESDNDQNNANQANNQAQNNQNQQQ ANQNQQQQQQRQGGGQRHTVNGQENLYRIAIQYYGSGSPENVEKIRRANGLSGNNIRNGQ QIVIP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ebpS |
Synonyms | ebpS; SAS1421; Elastin-binding protein EbpS |
UniProt ID | Q6G983 |
◆ Recombinant Proteins | ||
RFL23469SF | Recombinant Full Length Scyliorhinus Canicula Nadh-Ubiquinone Oxidoreductase Chain 3(Mt-Nd3) Protein, His-Tagged | +Inquiry |
SAP072A-025-1768S | Recombinant Staphylococcus aureus (strain: 30067, other: animal isolate) SAP072A_025 protein, His-tagged | +Inquiry |
IL1R1-4266H | Recombinant Human IL1R1 Protein (Met1-Thr332), C-Fc tagged | +Inquiry |
Cd81-1102R | Recombinant Rat Cd81 protein, mFc-tagged | +Inquiry |
ZFP637-19015M | Recombinant Mouse ZFP637 Protein | +Inquiry |
◆ Native Proteins | ||
HBsAg-ad-21H | Native Human HBsAg protein (Subtype ad) | +Inquiry |
GLDH-120B | Active Native Bovine Glutamate Dehydrogenase | +Inquiry |
ELANE-27537TH | Native Human ELANE | +Inquiry |
Glycogen-006B | Native Bovine or Rabbit Glycogen | +Inquiry |
GG-190H | Native Horse Gamma Globulin protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
NRIP3-3694HCL | Recombinant Human NRIP3 293 Cell Lysate | +Inquiry |
SCAPER-2004HCL | Recombinant Human SCAPER cell lysate | +Inquiry |
Epididymis-739R | Rabbit Epididymis Lysate, Total Protein | +Inquiry |
AMPD1-8877HCL | Recombinant Human AMPD1 293 Cell Lysate | +Inquiry |
USP47-728HCL | Recombinant Human USP47 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All ebpS Products
Required fields are marked with *
My Review for All ebpS Products
Required fields are marked with *
0
Inquiry Basket