Recombinant Full Length Idiomarina Loihiensis Lipid A Export Atp-Binding/Permease Protein Msba(Msba) Protein, His-Tagged
Cat.No. : | RFL20796IF |
Product Overview : | Recombinant Full Length Idiomarina loihiensis Lipid A export ATP-binding/permease protein MsbA(msbA) Protein (Q5QU36) (1-582aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Idiomarina loihiensis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-582) |
Form : | Lyophilized powder |
AA Sequence : | MDSQLKKKTTFKRLLGYIKPYKAAFIAAILCMIGYSAIDTLFLSQIETLIDDGLTEQDSN ILLYGALFVPFIFILRGSLNVASSYFLHWVGFKVVTKMRQQLFDHMMKLPVGFHDQHSTG DLISKITYDTQQVAEASSRAVLVLVKEGAFVAGLLGLMFYQSWQLSLVFLVIGPLVAKVV GVVSRRFRKVSSRIQTAMGNVTTTAEQMINGHKVVIMHQGQKGESTRFSEINNITRNQNM KLVNTRAISTSVIQFIASLSLSMVLVIASFPEMLGELSAGAFTTLLTAMIMLLRPLKQLT NVNSDFQRGIAAATSVFAILDEPIEVDKGSRVVDRAAGDIVFDDVTFSYQKDDEPALEHI NFKVDQGKTVALVGRSGSGKSTISNLLTRFYDVEQGSILLDGHNINDYKLKCLRRQFALV SQHVTLFNDTIANNIAYGASKDVSRENIIKAAEQAYVTEFTDSMPKGLDTMVGENGVMLS GGQRQRIAIARALLQDAPILILDEATSALDTESERHIQDALGTLRKNRTAIVIAHRLSTI ENADEILVMDNGEIIERGTHQQLLDQEGAYFQLHNLQFSGSA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | msbA |
Synonyms | msbA; IL1513; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA |
UniProt ID | Q5QU36 |
◆ Native Proteins | ||
CAPN1-186p | Active Native porcine Calpain-1 | +Inquiry |
C. jejuni-24 | Native Campylobacter jejuni Antigen | +Inquiry |
eCG-01E | Active Native Equine Gonadotropin protein | +Inquiry |
F2-5285H | Native Human Coagulation Factor II (thrombin) | +Inquiry |
Neuraminidase-011C | Active Native Clostridium perfringens Choloylglycine Hydrolase | +Inquiry |
◆ Cell & Tissue Lysates | ||
RBBP9-2488HCL | Recombinant Human RBBP9 293 Cell Lysate | +Inquiry |
LY6K-4597HCL | Recombinant Human LY6K 293 Cell Lysate | +Inquiry |
HEK293-008HCL | Human HEK293 Whole Cell Lysate | +Inquiry |
RPS24-2167HCL | Recombinant Human RPS24 293 Cell Lysate | +Inquiry |
NSUN4-3682HCL | Recombinant Human NSUN4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All msbA Products
Required fields are marked with *
My Review for All msbA Products
Required fields are marked with *
0
Inquiry Basket