Recombinant Full Length Cupriavidus Pinatubonensis Lipid A Export Atp-Binding/Permease Protein Msba(Msba) Protein, His-Tagged
Cat.No. : | RFL23985CF |
Product Overview : | Recombinant Full Length Cupriavidus pinatubonensis Lipid A export ATP-binding/permease protein MsbA(msbA) Protein (Q46Y89) (1-590aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Cupriavidus necator |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-590) |
Form : | Lyophilized powder |
AA Sequence : | MSNPAKSEQSAGHDVKVGKRLMGYLRPELRIFIAAILAMAVVAASEGVIPKVVNDLLDKG FGGEYAGKLWHVPAILTGVALIRGVAQFASGYLLSLISNRVLLKMRMQMFDRMLHAPAHF YHRNTAASLINAVIFEVNQVLSILTSVFITLVRDSLTVVALLIYLFYTNWRLTLIVSVIL PVIGYLMSKINRRLRRLNRDHQTLTNSAAYVVEEAAGGYKVVKLHGGEAYEMNRFRNMAD RLKNYSMRMAVAGGLNQPVTAFLAALALSVIITIAMIQAQGNQTTIGGFTGFVMAMLLLI SPLKHLTDINQPLTRGLTAAELIFRLIDEPVEPQDGGVRLERAKGDLVFERVGFRYGEGT RPALEGIDIRVPAGEVVALVGPSGSGKTTLVNLVPRFFDPTDGRILLDGHAIGDIALREL RNQIAFVSQDVVLFNDTVAANVAYGARSEEEIDMARVERALQAAYLTEVVKNLPEGVNTN IGDNGMKLSGGQRQRLAIARAIYKDAPILILDEATSALDSESERQVQAALEALMVGRTTL VIAHRLSTIENADRIVVLDHGRVAEHGTHEELLAANGLYAGLHRIQFATH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | msbA |
Synonyms | msbA; Reut_A2533; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA |
UniProt ID | Q46Y89 |
◆ Native Proteins | ||
IgA-238R | Native Rabbit Immunoglobulin A | +Inquiry |
Lectin-1861W | Active Native Wheat Germ Agglutinin Protein, Fluorescein labeled | +Inquiry |
Envelope-776W | Native purified West Nile Virus Envelope (E) Protein, His-tagged | +Inquiry |
SNCB-27206TH | Native Human SNCB | +Inquiry |
PR-01H | Native HIV1 PR Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLC35A2-1734HCL | Recombinant Human SLC35A2 293 Cell Lysate | +Inquiry |
NDST1-435HCL | Recombinant Human NDST1 lysate | +Inquiry |
PLA2G16-3143HCL | Recombinant Human PLA2G16 293 Cell Lysate | +Inquiry |
JAG1-2382HCL | Recombinant Human JAG1 cell lysate | +Inquiry |
H3F3A-5654HCL | Recombinant Human H3F3A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All msbA Products
Required fields are marked with *
My Review for All msbA Products
Required fields are marked with *
0
Inquiry Basket