Recombinant Full Length Burkholderia Cenocepacia Lipid A Export Atp-Binding/Permease Protein Msba(Msba) Protein, His-Tagged
Cat.No. : | RFL17529BF |
Product Overview : | Recombinant Full Length Burkholderia cenocepacia Lipid A export ATP-binding/permease protein MsbA(msbA) Protein (Q1BUV6) (1-593aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Burkholderia Cenocepacia |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-593) |
Form : | Lyophilized powder |
AA Sequence : | METQNTLRKPMDGTGTSPMTVLKRLWPYIRPLIGIVVLAVVTMGVVAATEAGIPALLKPL LDHGFGSHGSDSAKWYVPIAVIGLALVRGVSQYTSNYLLNYVSNRILLQLRLEMFQRMIH TGASFFQRETASTVINAIVFEVNQILSVLTGVMVTLVRDSLTVIFLLGYLFYLNWRLTLI VAVILPGIGWLVSKINRRLRRLNREHQTLTNELSYIVEETVGGYKVVKVHNGEAYEMDRF TTMSKRLRGYAMRMTISGGLAQPLTQFLASIALAVVITIAVVQSSNDQTTVGGFVAFVTS MLLVISPLKHLIDVNQPLQRGMTAAELIFGLIDEPAEPQGGGRPLSQARGEIEFRAVSFD YGAAERPTLDRISFKVAPGEMIALAGPSGSGKTTLVNLLPRFFDPTDGTILVDGVPVSDY DLHALRSQMAMVSQDVVLFNDTIAANVAYGQTPDRARVQAALEAANLADAVAAMPDGLDT LVGGNGMRLSGGQRQRLAIARAIYKDAPILILDEATSALDSESERHVQAALERLMEGRTT LVIAHRLSTIERADRILVLEAGKIVEEGSHDELLRHGGLYAHLHRIQYQQQAA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | msbA |
Synonyms | msbA; Bcen_1695; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA |
UniProt ID | Q1BUV6 |
◆ Recombinant Proteins | ||
ITGA4-1210H | Recombinant Human ITGA4 Protein, His (Fc)-Avi-tagged | +Inquiry |
IL13RA2-595HF | Recombinant Full Length Human IL13RA2 Protein | +Inquiry |
Sfpq-5814M | Recombinant Mouse Sfpq Protein, Myc/DDK-tagged | +Inquiry |
DOCK8-2251M | Recombinant Mouse DOCK8 Protein (561-730 aa), His-tagged | +Inquiry |
Odf3l1-4575M | Recombinant Mouse Odf3l1 Protein, Myc/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
Hp-25 | Native Helicobacter pylori Antigen | +Inquiry |
Fgg -65R | Native Rat Fibrinogen, FITC Labeled | +Inquiry |
Calmodulin-016 | Native Calmodulin Protein | +Inquiry |
EGF-26462TH | Native Human EGF | +Inquiry |
Lectin-1837S | Active Native Sambucus Nigra Lectin Protein, Agarose bound | +Inquiry |
◆ Cell & Tissue Lysates | ||
RHOG-542HCL | Recombinant Human RHOG lysate | +Inquiry |
DNAJC30-6872HCL | Recombinant Human DNAJC30 293 Cell Lysate | +Inquiry |
CLMP-1439RCL | Recombinant Rat CLMP cell lysate | +Inquiry |
C6orf223-126HCL | Recombinant Human C6orf223 lysate | +Inquiry |
NEUROG2-3864HCL | Recombinant Human NEUROG2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All msbA Products
Required fields are marked with *
My Review for All msbA Products
Required fields are marked with *
0
Inquiry Basket