Recombinant Full Length Candida Tropicalis Formation Of Crista Junctions Protein 1(Fcj1) Protein, His-Tagged
Cat.No. : | RFL15177CF |
Product Overview : | Recombinant Full Length Candida tropicalis Formation of crista junctions protein 1(FCJ1) Protein (C5M3V6) (26-567aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Candida tropicalis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (26-567) |
Form : | Lyophilized powder |
AA Sequence : | NTTQKVVVTPPPVATEGELPPPQPKVTPPKATPPPPPKTKRFSLFGFLLKTTLLASVVYG GTLYAATKNDKVMDFVVDNRLPYHEELLELIETGSIDDLQQGLDQLKSKFGSVKLPSKEE IDELAQKLEHKGEDIIKETKKKFTATRTGTDLTPSEQLQKGVEIESVKKDVPHLPLIELN SELGSSVDETVKQTIASFNNFIQTIDASTLASKNDKLIASINFSISQLASKLNGLTKSFD EELQKKLKVSQTELFSSFTKKELELTENLLHQFTTEKQQLEAKLNEKLNQEIQASRTAIS QAATNAVSMVRIEQTKNFEKLVTEKLNEERNGRLANLDKLNDRLTELEKFAEGFETQIVS NHKKALIQQAVSKLKSLLLAPAANEKPKSIKPYVDELSKIAADDEVLKLALKDLTPLLSN ESTHSILTNAQLLSRWEQLAPELRSASLLPPNAGLLGHLASIVFSKLLLPVKGVKQDGKD IESVIGRVESSLARGELDVAVEEAANLKGWSRKLANDWVVEGRKRLEVEFLLGLIESESK II |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MIC60 |
Synonyms | MIC60; CTRG_00745; MICOS complex subunit MIC60; Mitofilin |
UniProt ID | C5M3V6 |
◆ Recombinant Proteins | ||
Tyw3-6761M | Recombinant Mouse Tyw3 Protein, Myc/DDK-tagged | +Inquiry |
INSL3-722H | Recombinant Human INSL3 Protein, His-tagged | +Inquiry |
RFX3-7551M | Recombinant Mouse RFX3 Protein, His (Fc)-Avi-tagged | +Inquiry |
CAPNS1-1222M | Recombinant Mouse CAPNS1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL27486GF | Recombinant Full Length Geobacter Metallireducens Large-Conductance Mechanosensitive Channel(Mscl) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
Factor Xia-65H | Native Human Factor Xia | +Inquiry |
GFAP-171B | Native bovine GFAP | +Inquiry |
TF-47C | Native Cattle Transferrin (TRF) Protein | +Inquiry |
Glutamate oxaloacetate transaminase-385 | Active Native E. coli Glutamate oxaloacetate transaminase protein. | +Inquiry |
Immunoglobulin G3-83H | Native Human Immunoglobulin G3 | +Inquiry |
◆ Cell & Tissue Lysates | ||
PURG-2664HCL | Recombinant Human PURG 293 Cell Lysate | +Inquiry |
MPI-4235HCL | Recombinant Human MPI 293 Cell Lysate | +Inquiry |
IL2RG-1481HCL | Recombinant Human IL2RG cell lysate | +Inquiry |
GFOD2-697HCL | Recombinant Human GFOD2 cell lysate | +Inquiry |
H2AFY-5658HCL | Recombinant Human H2AFY 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MIC60 Products
Required fields are marked with *
My Review for All MIC60 Products
Required fields are marked with *
0
Inquiry Basket