Recombinant Full Length Xanthomonas Oryzae Pv. Oryzae Lipid A Export Atp-Binding/Permease Protein Msba(Msba) Protein, His-Tagged
Cat.No. : | RFL25924XF |
Product Overview : | Recombinant Full Length Xanthomonas oryzae pv. oryzae Lipid A export ATP-binding/permease protein MsbA(msbA) Protein (Q2P3E7) (1-589aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Xanthomonas oryzae pv. oryzae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-589) |
Form : | Lyophilized powder |
AA Sequence : | MTNSTDRPVSVSSWRTYRRLVAFAKPYRLLLVAALIAALIEAAGTTGFLALMKPITDETF IYKNAEVSRWLPVQIILLFVVRGIAGYITDMAMGKSARSIARDLRIKVMAKYLRLPGSRF DSEPVPSMLIRLGSDSDQVAQAAVDAIKVMIQQSLQVIGALALMLWHSWQVTLTILVLAP VLAWVMDKVARRYRRISHSIQESGAHLLQAADQTLSSHQEVKIYGAQQTEMERYGALADR NLRLAMKVESTRGISTATVQMIGAIGLSALLFVAGAQALAGRLTAGDFVVLMTSMLTIIP GLKQLTNVQNMVQRGLASAERLFSVLDSPDEPDQGAVALTRAKGLIEFRDVTARYPGQVN PALADVSFIAQPGTVTAIVGRSGSGKSSLIKLIPRFYDAEAGQILLDGQPVQAYALADLR RQIALVGQQVMLFDGSIAENVAFGEMRSADASQLERAILGANAMEFVAQLPEGLQSHVGA KGGRLSGGQRQRLAIARAMLKDAPILILDEATAALDNESERLVQDALHKLMPDRTTLVIA HRLSTIEHADQVLVMDQGRIVERGTHHELLAQGGLYSHLHGMQFRERQA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | msbA |
Synonyms | msbA; XOO2175; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA |
UniProt ID | Q2P3E7 |
◆ Recombinant Proteins | ||
HIV1-0075H | Recombinant HIV1 antigen | +Inquiry |
ICA-428M | Recombinant Mouse ICA protein, His-tagged | +Inquiry |
KSR1-008H | Recombinant Human kinase suppressor of ras 1 Protein, His tagged | +Inquiry |
TERF1-1537H | Recombinant Human TERF1 protein | +Inquiry |
IL2RA-134CF | Recombinant Cynomolgus IL2RA Protein, His-tagged, FITC conjugated | +Inquiry |
◆ Native Proteins | ||
ORM1-27283TH | Native Human ORM1 | +Inquiry |
CTSB-26408TH | Native Human CTSB | +Inquiry |
Angiostatin K1-4-22H | Native Human Angiostatin K1-4 Protein | +Inquiry |
CTRC-1209B | Native Bovine Chymotrypsin C (Caldecrin) | +Inquiry |
Lectin-1842S | Active Native Solanum Tuberosum Lectin Protein, Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
JAK3-5106HCL | Recombinant Human JAK3 293 Cell Lysate | +Inquiry |
FAM53B-266HCL | Recombinant Human FAM53B lysate | +Inquiry |
PBL-01HCL | Human Peripheral blood leukocyte lysate | +Inquiry |
SULT1A4-1353HCL | Recombinant Human SULT1A4 293 Cell Lysate | +Inquiry |
SLC25A34-1766HCL | Recombinant Human SLC25A34 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All msbA Products
Required fields are marked with *
My Review for All msbA Products
Required fields are marked with *
0
Inquiry Basket