Recombinant Full Length Escherichia Coli Lipid A Export Atp-Binding/Permease Protein Msba(Msba) Protein, His-Tagged
Cat.No. : | RFL10001EF |
Product Overview : | Recombinant Full Length Escherichia coli Lipid A export ATP-binding/permease protein MsbA(msbA) Protein (Q1RDU4) (1-582aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-582) |
Form : | Lyophilized powder |
AA Sequence : | MHNDKDLSTWQTFRRLWPTIAPFKAGLIVAGVALILNAASDTFMLSLLKPLLDDGFGKTD RSVLMWMPLVVIGLMILRGITSYISSYCISWVSGKVVMTMRRRLFGHMMGMPVSFFDKQS TGTLLSRITYDSEQVASSSSGALITVVREGASIIGLFIMMFYYSWQLSIILIVLAPIVSI AIRVVSKRFRNISKNMQNTMGQVTTSAEQMLKGHKEVLIFGGQEVETKRFDKVSNRMRLQ GMKMVSASSISDPIIQLIASLALAFVLYAASFPSVMDSLTAGTITVVFSSMIALMRPLKS LTNVNAQFQRGMAACQTLFTILDSEQEKDEGKRVIERATGDVEFRNVTFTYPGRDVPALR NINLKIPAGKTVALVGRSGSGKSTIASLITRFYDIDEGEILMDGHDLREYTLASLRNQVA LVSQNVHLFNDTVANNIAYARTEQYSREQIEEAARMAYAMDFINKMDNGLDTVIGENGVL LSGGQRQRIAIARALLRDSPILILDEATSALDTESERAIQAALDELQKNRTSLVIAHRLS TIEKADEIVVVEDGVIVERGTHNDLLEHRGVYAQLHKMQFGQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | msbA |
Synonyms | msbA; UTI89_C0985; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA |
UniProt ID | Q1RDU4 |
◆ Native Proteins | ||
SERPINA1-27286TH | Native Human SERPINA1 | +Inquiry |
Cyfra-21-1-01H | Native Human MCF-7 Cell Cyfra-21-1 Antigen | +Inquiry |
CA-13B | Active Native Bovine Carbonic Anhydrase | +Inquiry |
IgG-119S | Native Sheep Immunoglobulin G | +Inquiry |
PAP-01H | Active Native Human PAP | +Inquiry |
◆ Cell & Tissue Lysates | ||
C1D-8193HCL | Recombinant Human C1D 293 Cell Lysate | +Inquiry |
PLCL2-3126HCL | Recombinant Human PLCL2 293 Cell Lysate | +Inquiry |
MB21D1-7994HCL | Recombinant Human C6orf150 293 Cell Lysate | +Inquiry |
HA-1665HCL | Recombinant H6N4 HA cell lysate | +Inquiry |
IQGAP3-869HCL | Recombinant Human IQGAP3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All msbA Products
Required fields are marked with *
My Review for All msbA Products
Required fields are marked with *
0
Inquiry Basket