Recombinant Full Length Vibrio Vulnificus Lipid A Export Atp-Binding/Permease Protein Msba(Msba) Protein, His-Tagged
Cat.No. : | RFL8768VF |
Product Overview : | Recombinant Full Length Vibrio vulnificus Lipid A export ATP-binding/permease protein MsbA(msbA) Protein (Q7MJ07) (1-583aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Vibrio Vulnificus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-583) |
Form : | Lyophilized powder |
AA Sequence : | MSINTDESTWRTFKRLWTFIRLYKSGLAVAVVALIINAVSDTYMVSLLKPLLDEGFGSAE SDFLRTLPLLVFGLMFIRGISSFVSTYCLSWVSGNVVMQVRRMVFNHYMQMPVSYFDKEK SGSLLSRITYDSEQVSAATSQALVSIVREGTSIIGLLVLMFYNSWQLSLVLILVAPVVAW AIGFVSKRFRKISKNMQTTMGIVTSSAEQMLKGHKVVLSYGGQEVEKSRFDVVSNQMRQQ SMKLITAQAAANPIIQMIASIAIVVVLYLASVDTIKDQLTPGTFTVVFSAMFGLMRPLKA LTNVTSQFQRGMAAAQTLFALVDLEPEKNTGTYSVERAKGEVNVKDISFTYEGAEKPALS HVSFDIPRGKTVALVGRSGSGKSTIANLFTRFYDVDSGEIQLDGVDVRDYELKNLRTQFA LVSQNVHLFNDTIANNIAYAAGDKYSREDIERAAELAHAMEFISKMENGLDTVVGENGAS LSGGQRQRVAIARALLRDAPVLILDEATSALDTESERAIQSALDELQKNKTVLVIAHRLS TIEKADQILVIDDGAVVERGSHSELIEKDGAYAQLHRIQFGEG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | msbA |
Synonyms | msbA; VV2357; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA |
UniProt ID | Q7MJ07 |
◆ Recombinant Proteins | ||
CD33-3162HF | Recombinant Full Length Human CD33 Protein, GST-tagged | +Inquiry |
Il20-3510M | Recombinant Mouse Il20 Protein, Myc/DDK-tagged | +Inquiry |
VAMP5-31700TH | Recombinant Human VAMP5, His-tagged | +Inquiry |
RHNO1-1210H | Recombinant Human RHNO1 | +Inquiry |
CDK13-02H | Recombinant Human CDK13 protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
THBD-306R | Active Native Rabbit Lung Thrombomodulin | +Inquiry |
CTLGV2EB-359C | Active Native Chlamydia trachomatis LGV Type-2 EB Protein | +Inquiry |
Actin-889P | Native Porcine Actin Protein | +Inquiry |
FGG -60R | Native Rabbit Fibrinogen | +Inquiry |
Immunoglobulin A2-78H | Native Human Immunoglobulin A2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
PTPRJ-2675HCL | Recombinant Human PTPRJ 293 Cell Lysate | +Inquiry |
Rgr-1498HCL | Recombinant Human Rgr cell lysate | +Inquiry |
ZNF192P1-1022HCL | Recombinant Human ZNF192P1 cell lysate | +Inquiry |
C9orf142-138HCL | Recombinant Human C9orf142 lysate | +Inquiry |
MSRB3-4106HCL | Recombinant Human MSRB3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All msbA Products
Required fields are marked with *
My Review for All msbA Products
Required fields are marked with *
0
Inquiry Basket