Recombinant Full Length Burkholderia Mallei Lipid A Export Atp-Binding/Permease Protein Msba(Msba) Protein, His-Tagged
Cat.No. : | RFL4719BF |
Product Overview : | Recombinant Full Length Burkholderia mallei Lipid A export ATP-binding/permease protein MsbA(msbA) Protein (Q62IG3) (1-596aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Burkholderia Mallei |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-596) |
Form : | Lyophilized powder |
AA Sequence : | MSVKPTLSKPIGGQDASSPAVVMRRLWPYVKPLVWVLVAGVLAMAAVAATEAGIPALLKP LLDHGFGSKGDMTTKLYVPAAVVGLALARAIAQYASGYLLQYVSNRILLDLRIQMFERMI HTGVSFFQRETASTVINAVVFEVNQVLSVLMGVTITLVRDSLTVVFLLGYLFYLNWRLTL IVAILLPCIGWLVGKINRRLRRLNREHQTLTNQLAYIVEETVGGYKVVKVHNGEPYEIGR FNELSRKLRGYSMRMTVSGGLAQPLTQFLASIALAVVLTIAVVQSANDQTTVGGFVAFVT AMLLIISPLKHLMDVNQPLQRGMTAAELIFGLIDEPREPEGGGKPLARASGAIEFSHVSF SYGMSRDGRQTLDDVSFTVAPGEMVALAGPSGSGKTTLVNLLPRFFDPSSGSVRVDGVAL PEYSLRDLRNQIAMVSQDVVLFNDTIAANVAYGQAPERDRVEAALRAANLWETVTAMPDG IDTLVGDNGMRLSGGQRQRLAIARAIYKDAPILILDEATSALDSESERHVQAALETLMKG RTTLVIAHRLSTIERADRILVLEGGKIVESGSHRELLEQGGLYAHLHRIQFQQDAG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | msbA |
Synonyms | msbA; BMA1912; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA |
UniProt ID | Q62IG3 |
◆ Recombinant Proteins | ||
Reg1a-8766R | Recombinant Rat Reg1a protein, hFc-tagged | +Inquiry |
ZFAND3-6325R | Recombinant Rat ZFAND3 Protein, His (Fc)-Avi-tagged | +Inquiry |
PLK2-31029TH | Recombinant Human PLK2 | +Inquiry |
GTF2A2-27775TH | Recombinant Human GTF2A2 | +Inquiry |
RFL18712CF | Recombinant Full Length Candida Albicans Mitochondrial Inner Membrane Magnesium Transporter Mrs2(Mrs2) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
Collagen-55B | Native Bovine Collagen Type II | +Inquiry |
VTN-31735TH | Native Human VTN | +Inquiry |
DENV2-01DCL | Native DENV2 Lysate | +Inquiry |
CTSB-1647H | Native Human Cathepsin B | +Inquiry |
APOC1-8038H | Native Human ApoLipoprotein CI | +Inquiry |
◆ Cell & Tissue Lysates | ||
LUZP1-4605HCL | Recombinant Human LUZP1 293 Cell Lysate | +Inquiry |
MDH1-4409HCL | Recombinant Human MDH1 293 Cell Lysate | +Inquiry |
BCL6B-8478HCL | Recombinant Human BCL6B 293 Cell Lysate | +Inquiry |
CYP26A1-7121HCL | Recombinant Human CYP26A1 293 Cell Lysate | +Inquiry |
GPBP1-303HCL | Recombinant Human GPBP1 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All msbA Products
Required fields are marked with *
My Review for All msbA Products
Required fields are marked with *
0
Inquiry Basket