Recombinant Full Length Salmonella Choleraesuis Lipid A Export Atp-Binding/Permease Protein Msba(Msba) Protein, His-Tagged
Cat.No. : | RFL19726SF |
Product Overview : | Recombinant Full Length Salmonella choleraesuis Lipid A export ATP-binding/permease protein MsbA(msbA) Protein (Q57R14) (1-582aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Salmonella choleraesuis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-582) |
Form : | Lyophilized powder |
AA Sequence : | MHNDKDLSTWQTFRRLWPTIAPFKAGLIVAGIALILNAASDTFMLSLLKPLLDDGFGKTD RSVLLWMPLVVIGLMILRGITSYISSYCISWVSGKVVMTMRRRLFGHMMGMPVAFFDKQS TGTLLSRITYDSEQVASSSSGALITVVREGASIIGLFIMMFYYSWQLSIILVVLAPIVSI AIRVVSKRFRSISKNMQNTMGQVTTSAEQMLKGHKEVLIFGGQEVETKRFDKVSNKMRLQ GMKMVSASSISDPIIQLIASLALAFVLYAASFPSVMDSLTAGTITVVFSSMIALMRPLKS LTNVNAQFQRGMAACQTLFAILDSEQEKDEGKRVIDRATGDLEFRNVTFTYPGREVPALR NINLKIPAGKTVALVGRSGSGKSTIASLITRFYDIDEGHILMDGHDLREYTLASLRNQVA LVSQNVHLFNDTVANNIAYARTEEYSREQIEEAARMAYAMDFINKMDNGLDTIIGENGVL LSGGQRQRIAIARALLRDSPILILDEATSALDTESERAIQAALDELQKNRTSLVIAHRLS TIEQADEIVVVEDGIIVERGTHSELLAQHGVYAQLHKMQFGQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | msbA |
Synonyms | msbA; SCH_0941; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA |
UniProt ID | Q57R14 |
◆ Recombinant Proteins | ||
YBX1-6756Z | Recombinant Zebrafish YBX1 | +Inquiry |
PBDC1-426H | Recombinant Human PBDC1 Protein, MYC/DDK-tagged | +Inquiry |
S-450S | Recombinant SARS-CoV-2 Spike S1 (K417N, E484K, N501Y, D614G) Protein, His-tagged | +Inquiry |
RFL2992MF | Recombinant Full Length Mouse Mitochondrial Thiamine Pyrophosphate Carrier(Slc25A19) Protein, His-Tagged | +Inquiry |
LRGUK-9222M | Recombinant Mouse LRGUK Protein | +Inquiry |
◆ Native Proteins | ||
fH-10R | Native Rat fH Protein | +Inquiry |
Collagen Type I & III-04B | Native Bovine Collagen Type I and III Protein | +Inquiry |
Ighg2b-162M | Native Mouse Immunoglobulin G2b | +Inquiry |
NPPB-8052R | Native Rat Brain Natriuretic Peptide-32 | +Inquiry |
GFAP-526H | Native Human GFAP protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
LNPEP-4705HCL | Recombinant Human LNPEP 293 Cell Lysate | +Inquiry |
PHYH-3213HCL | Recombinant Human PHYH 293 Cell Lysate | +Inquiry |
COX4I2-388HCL | Recombinant Human COX4I2 cell lysate | +Inquiry |
FGF19-6244HCL | Recombinant Human FGF19 293 Cell Lysate | +Inquiry |
NGFRAP1-1191HCL | Recombinant Human NGFRAP1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All msbA Products
Required fields are marked with *
My Review for All msbA Products
Required fields are marked with *
0
Inquiry Basket