Recombinant Full Length Bovine Protein Tweety Homolog 1(Ttyh1) Protein, His-Tagged
Cat.No. : | RFL29860BF |
Product Overview : | Recombinant Full Length Bovine Protein tweety homolog 1(TTYH1) Protein (Q2KJ98) (1-450aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-450) |
Form : | Lyophilized powder |
AA Sequence : | MGAPPGYRPSAWVHLLHQLPRADFQLRPVPSAFAPQEREYQQALLLVAALAGLGLGLSLI FIAVYLIRFCCCRPPEPPGAKSPPPGGGCVTWNCIAALLVGCAGIGVGFYGNSETSDGVS QLSSALLHANHTLTAIDHLVLEMVERLNEAVRTELTTLEEVLTQRTELVAAARGARRQAE TVAQQLQGLAFWRGVPLSPLQVAEDVSFVEEYRWLAYVLLLLLELLVCLFTLLGLARQSK WLVIVMTVMSLLVLVLSWGSMGLEAATAVGLSDFCSSPDSYILNLTQEETGLGSDILNYY FLCNQAVSNPFQQRLTLSQRALANIHSQLQGLEREAVPQFPSAQKPVLSLEETLNVTEGN FHQLVALLHCRGLHKDYGSALRGLCEDTLEGLLFLLLFSLLSAGALATVLCSLPRAWALF PPSDDYEDTDDDDPFNPQESKRFVQWQSSI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TTYH1 |
Synonyms | TTYH1; Protein tweety homolog 1 |
UniProt ID | Q2KJ98 |
◆ Native Proteins | ||
COL2A1-1648H | Native Human COL2A1 Protein | +Inquiry |
IgG4-232H | Native Human Immunoglobulin G4 (IgG4) | +Inquiry |
ALP-151P | Active Native Porcine Kidney Alkaline Phosphatase | +Inquiry |
LTA-14S | Native S. aureus LTA Protein | +Inquiry |
PNLIP-1175P | Native Porcine Pancreatic Lipase | +Inquiry |
◆ Cell & Tissue Lysates | ||
CYP4F12-7102HCL | Recombinant Human CYP4F12 293 Cell Lysate | +Inquiry |
ARL4D-8711HCL | Recombinant Human ARL4D 293 Cell Lysate | +Inquiry |
CPSF4-7302HCL | Recombinant Human CPSF4 293 Cell Lysate | +Inquiry |
Fetal Kidney-146H | Human Fetal Kidney Membrane Lysate | +Inquiry |
DDX31-7009HCL | Recombinant Human DDX31 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All TTYH1 Products
Required fields are marked with *
My Review for All TTYH1 Products
Required fields are marked with *
0
Inquiry Basket