Recombinant Full Length Macaca Fascicularis Protein Tweety Homolog 1(Ttyh1) Protein, His-Tagged
Cat.No. : | RFL3887MF |
Product Overview : | Recombinant Full Length Macaca fascicularis Protein tweety homolog 1(TTYH1) Protein (Q9MZZ8) (1-450aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Macaca fascicularis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-450) |
Form : | Lyophilized powder |
AA Sequence : | MGAPPGYRPSAWVHLLHQLPRADFQLRPVPSGFAPQEQEYQQALLLVAALAGLGLGLSLI FIAVYLIRFCCCRPPEPPGSKTPSPGGGCVTWSCIVALLAGCIGIGIGFYGNSETSDGVS QLSSALLHANHTLSAIDHLVLETVERLGEAVRTELTTLEEVLEPRTELVAAARGARRQAE AVAQQLQGLAFWQGVPLSPLQVAEDVSFVEEYRWLAYVLLLLLELLVCLFTLLGLAKQSK WLVIVMTVMSLLVLVLSWGSMGLEAATAVGLSDFYSNPDPYVLNLTQEETGLSSDILSYY FLCNQAVSNPFQQRLTLSQRALANIHSQLLGLEREAVPQFPSAQKPLLSLEETLNVTEGN FHQLVALLHCRGLHKDYGAALRGLCEDALEGLLFLLLFSLLSAGALATALCSLPRAWALF PPSDDYDDTDDDDPFNPQESKRFVQWQSSI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TTYH1 |
Synonyms | TTYH1; QccE-16395; QccE-16959; Protein tweety homolog 1 |
UniProt ID | Q9MZZ8 |
◆ Recombinant Proteins | ||
IL18-547H | Active Recombinant Human IL18, HIgG1 Fc-tagged, mutant | +Inquiry |
EEF2KMT-1206H | Recombinant Human EEF2KMT Protein, MYC/DDK-tagged | +Inquiry |
Upb1-7919M | Recombinant Mouse Upb1 protein, His & T7-tagged | +Inquiry |
BLOC1S1-1710HF | Recombinant Full Length Human BLOC1S1 Protein, GST-tagged | +Inquiry |
HSPB9-3970HF | Recombinant Full Length Human HSPB9 Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
VEGFA-31701TH | Native Human VEGFA | +Inquiry |
Trf-4782M | Native Mouse Transferrin | +Inquiry |
slo-01S | Active Native Streptococcus pyogenes Streptolysin O protein | +Inquiry |
LDH3-22H | Active Native Human Lactate Dehydrogenase 3 | +Inquiry |
TF-47C | Native Cattle Transferrin (TRF) Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
BACE1-3006HCL | Recombinant Human BACE1 cell lysate | +Inquiry |
PORCN-492HCL | Recombinant Human PORCN lysate | +Inquiry |
Liver-492C | Chicken Liver Lysate, Total Protein | +Inquiry |
KCMF1-5080HCL | Recombinant Human KCMF1 293 Cell Lysate | +Inquiry |
POU2AF1-3004HCL | Recombinant Human POU2AF1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TTYH1 Products
Required fields are marked with *
My Review for All TTYH1 Products
Required fields are marked with *
0
Inquiry Basket