Recombinant Full Length Rat Protein Tweety Homolog 1(Ttyh1) Protein, His-Tagged
Cat.No. : | RFL2015RF |
Product Overview : | Recombinant Full Length Rat Protein tweety homolog 1(Ttyh1) Protein (P0C5X8) (1-450aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-450) |
Form : | Lyophilized powder |
AA Sequence : | MGAPPGYRPSAWVHLLHQLPRADFQLRPVPSGFAPRDQEYQQALLLVAALAGLGLGLSLI FIAVYLIRFCCCRPPEPPGAKSPPPGGGCVTWSCIAALLVGCAGIGIGFYGNSETSDGVS QLSSALQHANHTLSTIDDLVLETVERLGEAVRTELTTLEEVLSERVELVAATRGARRQAE AAAQHLQGLAFWQGVSLSPVQVAEDVTFVEEYRWLAYVLLLLLVLLVCLFTLLGLAKQSK WLVVVMTAMSLLVLVLSWGSMGLEAATAVGLSDFCSNPDTYVLNLTQEETGISSDILNYY FLCNQAVSNPFQQRLTLSQRALASIHSQLQGLEREASPQFPAAQKPLLSLEETLNVTERS FHQLVALLHCRSLHKDYGSALRGLCEDALEGLLFLMLFSLLSAGALATTLCSLPRAWALF PPSDDYDDTDDDDPFNPQESKRFVQWQSSI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Ttyh1 |
Synonyms | Ttyh1; Protein tweety homolog 1 |
UniProt ID | P0C5X8 |
◆ Recombinant Proteins | ||
CDYL-1554M | Recombinant Mouse CDYL Protein, His (Fc)-Avi-tagged | +Inquiry |
IL10-2921Z | Recombinant Zebrafish IL10 | +Inquiry |
GOLT1B-7071M | Recombinant Mouse GOLT1B Protein | +Inquiry |
RFL36115DF | Recombinant Full Length Dictyostelium Discoideum Putative Transmembrane Protein Ddb_G0267530(Ddb_G0267530) Protein, His-Tagged | +Inquiry |
GADD45B-4659H | Recombinant Human GADD45B Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
C3-8391H | Native Human C3 | +Inquiry |
MMP8-89H | Native Human Pro-MMP-8 | +Inquiry |
Liver-021H | Human Liver Lysate, Total Protein | +Inquiry |
TG-31519TH | Native Human TG | +Inquiry |
PLF4-88H | Active Native Human PF 4 | +Inquiry |
◆ Cell & Tissue Lysates | ||
PDE6B-3346HCL | Recombinant Human PDE6B 293 Cell Lysate | +Inquiry |
ATCAY-8634HCL | Recombinant Human ATCAY 293 Cell Lysate | +Inquiry |
RPL31-2206HCL | Recombinant Human RPL31 293 Cell Lysate | +Inquiry |
MARCO-2563MCL | Recombinant Mouse MARCO cell lysate | +Inquiry |
PLEKHF2-1374HCL | Recombinant Human PLEKHF2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All Ttyh1 Products
Required fields are marked with *
My Review for All Ttyh1 Products
Required fields are marked with *
0
Inquiry Basket