Recombinant Full Length Xenopus Tropicalis Protein Tweety Homolog 1(Ttyh1) Protein, His-Tagged
Cat.No. : | RFL18556XF |
Product Overview : | Recombinant Full Length Xenopus tropicalis Protein tweety homolog 1(ttyh1) Protein (Q0V9V9) (1-449aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-449) |
Form : | Lyophilized powder |
AA Sequence : | MSSSHGYRASWWTYILHQVPHTNFQFEVVDNQFAPQEWPYQQALLFLASIAGLCLAISLI LICVYLIRFCCCSSQEDDDSKSHRVCCVTWSCVAAVIICCAGIGIGFYGNSETNDGVYQV TYSLMNANHTLTSINLLISDTVELLSSVVRSDLTQLEEIFSKRTEFLVMIRNTRRQVESV AQQLAEISFWKGPEPNPNALAEQVNFIEDYRWLAYILLLLLDLIICLFTLLGLAKQIKWL VIVMTVVSFFVLLLSWGSMGLEMATAVGLSDFCSDPDAYVMNQTQAITNINPDILQYYIS CNQDVTNPFRQRLTMSQRALSNIHSQLHGLEREAVPQFPTAEKNLLVVQGMLNTTEGNFH HLVALLNCRGLHKDYVDALKGLCYDGMEGILFLLLFSFLSALSFTAAICSLPRAWKRFQN RDLDYDDMDEDDPFNPQESKRFVQWQSSI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ttyh1 |
Synonyms | ttyh1; Protein tweety homolog 1 |
UniProt ID | Q0V9V9 |
◆ Recombinant Proteins | ||
CHODL-1258H | Recombinant Human CHODL Protein, GST-Tagged | +Inquiry |
KCNN2-2875R | Recombinant Rat KCNN2 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL11596RF | Recombinant Full Length Rickettsia Bellii Dna Translocase Ftsk(Ftsk) Protein, His-Tagged | +Inquiry |
TNFRSF25-10H | Active Recombinant Human TNFRSF25 Protein, hIgG/His-tagged | +Inquiry |
Aequorin-1-543W | Recombinant Water jellyfish Aequorin-1 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
ALB-5362B | Native Bovine Albumin | +Inquiry |
ALP-8330C | Native Calf ALP | +Inquiry |
Collagen type I & III-185 | Native Porcine Collagen type I & III Protein | +Inquiry |
HGF-38P | Native Porcine HGF | +Inquiry |
Avidin-155C | Active Native Chicken Egg White Avidin | +Inquiry |
◆ Cell & Tissue Lysates | ||
FAM96B-6337HCL | Recombinant Human FAM96B 293 Cell Lysate | +Inquiry |
CLDN3-7463HCL | Recombinant Human CLDN3 293 Cell Lysate | +Inquiry |
PCDHB13-3393HCL | Recombinant Human PCDHB13 293 Cell Lysate | +Inquiry |
EFNA3-2160MCL | Recombinant Mouse EFNA3 cell lysate | +Inquiry |
EIF5A-6641HCL | Recombinant Human EIF5A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ttyh1 Products
Required fields are marked with *
My Review for All ttyh1 Products
Required fields are marked with *
0
Inquiry Basket