Recombinant Full Length Bordetella Bronchiseptica Lipid A Export Atp-Binding/Permease Protein Msba(Msba) Protein, His-Tagged
Cat.No. : | RFL35817BF |
Product Overview : | Recombinant Full Length Bordetella bronchiseptica Lipid A export ATP-binding/permease protein MsbA(msbA) Protein (Q7WH20) (1-623aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bordetella Bronchiseptica |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-623) |
Form : | Lyophilized powder |
AA Sequence : | MLAWRPGRPDGCRAAGGRRYNPGHDCIKASVSLNSAARNAPAGSQPVKAELWKRVYSRVG SYWKGLVLAVLLMAGAAATQPTLAVIMKPLLDDGFSGAKPHYVWFLPLAVVGLILLRGIC NFFSDYLLAWVANNVLRGIRGEMFERLLGLPDADFKRGDTGRLLNRFTIDAGNVTGYATD VITVLVRETLVVIALIGVLLYMSWALTLIILVMLPVSVGIARAFTRRLRRINRETVNMNA ELTRVVSEGIDGQRVIKLFDGYDAERRRFDFVNSRLRRFAMRSATADAALTPLTQVCISV AVGAVIAVALSQANSGALTVGSFASFMAALAQIFDPIKRLTNLAGKMQKMLVAAESVFTL VDQTPEADAGTRALPEPVRGKVEFRAVSHRFPDADRDTVSAVSFLVEPGQTVALVGRSGS GKTTLVNMLPRFVLPDGGDILFDDVPIQDLTLRSLRSHLSLVSQDVVLFDDTIAANVGYG AGGTVDDARVRDALAAANLLEFVDGLPLGIHTPVGQNAARLSGGQRQRLAIARALIKNAP VLILDEATSALDNESERQVQASLERLMRGRTTLVIAHRLSTVQNADRIIVLDAGKIVEHG PHSELLAANGLYASLYNMQFRED |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | msbA |
Synonyms | msbA; BB3390; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA |
UniProt ID | Q7WH20 |
◆ Native Proteins | ||
Collagen Type Ⅱ-525B | Native Bovine Type Collagen Type Ⅱ Protein | +Inquiry |
Thrombin-61M | Active Native Mouse Thrombin | +Inquiry |
hypogaea 2S-156A | Native Arachis hypogaea 2S protein | +Inquiry |
PLAU-31777TH | Native Human Human SERPINE1 | +Inquiry |
BNP-1276P | Native Porcine Brain Natriuretic Peptide | +Inquiry |
◆ Cell & Tissue Lysates | ||
PARK7-3432HCL | Recombinant Human PARK7 293 Cell Lysate | +Inquiry |
MTMR2-4075HCL | Recombinant Human MTMR2 293 Cell Lysate | +Inquiry |
Lung-313R | Rhesus monkey Lung Lysate | +Inquiry |
CDH5-2570MCL | Recombinant Mouse CDH5 cell lysate | +Inquiry |
THUMPD2-1084HCL | Recombinant Human THUMPD2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All msbA Products
Required fields are marked with *
My Review for All msbA Products
Required fields are marked with *
0
Inquiry Basket