Recombinant Full Length Shigella Boydii Serotype 4 Lipid A Export Atp-Binding/Permease Protein Msba(Msba) Protein, His-Tagged
Cat.No. : | RFL32404SF |
Product Overview : | Recombinant Full Length Shigella boydii serotype 4 Lipid A export ATP-binding/permease protein MsbA(msbA) Protein (Q31YT6) (1-582aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Shigella boydii serotype 4 |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-582) |
Form : | Lyophilized powder |
AA Sequence : | MHNDKDLSTWQTFRRLWPTIAPFKAGLIVAGVALILNAASDTFMLSLLKPLLDDGFGKTD RSVLVWMPLVVIGLMILRGITSYVSSYCISWVSGKVVMTMRRRLFGHMMGMPVSFFDKQS TGTLLSRITYDSEQVASSSSGALITVVREGASIIGLFIMMFYYSWQLSIILIVLAPIVSI AIRVVSKRFRNISKNMQNTMGQVTTSAEQMLKGHKEVLIFGGQEVETKRFDKVSNRMRLQ GMKMVSASSISDPIIQLIASLALAFVLYAASFPSVMDSLTAGTITVVFSSMIALMRPLKS LTNVNAQFQRGMAACQTLFTILDSEQEKDEGKRVIERATGDVEFRNVTFTYPGRDVPALR NINLKIPAGKTVALVGRSGSGKSTIASLITRFYDIDEGEILMDGHDLREYTLASLRNQVA LVSQNVHLFNDTVANNIAYARTEQYSREQIEEAARMAYAMDFINKMDNGLDTVIGENGVL LSGGQRQRIAIARALLRDSPILILDEATSALDTESERAIQAALDELQKNRTSLVIAHRLS TIEKADEIVVVEDGVIVERGTHNDLLEHRGVYAQLHKMQFGQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | msbA |
Synonyms | msbA; SBO_2202; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA |
UniProt ID | Q31YT6 |
◆ Recombinant Proteins | ||
CCL17-192H | Recombinant Human CCL17 protein | +Inquiry |
SDHD-1466C | Recombinant Chicken SDHD | +Inquiry |
RPS6KB2-6202H | Recombinant Human RPS6KB2 Protein (Asp194-Pro453), N-His tagged | +Inquiry |
LAX1-8972M | Recombinant Mouse LAX1 Protein | +Inquiry |
CYTIP-4254M | Recombinant Mouse CYTIP Protein | +Inquiry |
◆ Native Proteins | ||
CRP-59C | Native Canine C-Reactive Protein | +Inquiry |
Y. enterocolitica-29 | Native Yersinia enterocolitica O:3 Antigen | +Inquiry |
INS-512D | Native Bovine INS | +Inquiry |
Thrombin-61M | Active Native Mouse Thrombin | +Inquiry |
AsAGP-002B | Native Bovine Asialo-a1-acid glycoprotein Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MRPL43-4166HCL | Recombinant Human MRPL43 293 Cell Lysate | +Inquiry |
Duodenum-472C | Cat Duodenum Lysate, Total Protein | +Inquiry |
SLC14A1-1803HCL | Recombinant Human SLC14A1 293 Cell Lysate | +Inquiry |
PFKFB2-3275HCL | Recombinant Human PFKFB2 293 Cell Lysate | +Inquiry |
CMKLR1-189HCL | Recombinant Human CMKLR1 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All msbA Products
Required fields are marked with *
My Review for All msbA Products
Required fields are marked with *
0
Inquiry Basket