Recombinant Full Length Thiobacillus Denitrificans Lipid A Export Atp-Binding/Permease Protein Msba(Msba) Protein, His-Tagged
Cat.No. : | RFL24621TF |
Product Overview : | Recombinant Full Length Thiobacillus denitrificans Lipid A export ATP-binding/permease protein MsbA(msbA) Protein (Q3SFZ6) (1-579aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Thiobacillus denitrificans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-579) |
Form : | Lyophilized powder |
AA Sequence : | MSAPTSRHLYGRLLGYVKPHWRMFALSIVGLILTAATEPMLPALFKPLLDEGFVAKDQDF IRWVPLLLLGLFVLRGVASFISTYSMAWVGSRLVMDLRAAMFDKLMALPTRYFDQNPSGQ LIAQLAFNVTQVTQSATSSLTTLVRDTVTVLGLLGYLVWLNWRLTLIVFALVPLTLWVVR VASKRLRGLSRKAQENIGDLTQVVDEAVGGHRVVKLYGGETYEQARFHRAANLARQFEMK RVAANAVYEPVIQFIAAIALAIIVFIAAGQASANTTTVGGFVAFFMAMLLLFAPLKRLTA VNDQLQRGLAASETIFALLDQDAERDTGTREPAHIEGRLAFRDVGLTYPGKQTPALARIS LDIAPGETVALVGASGSGKTTLANLVPRFYDPDAGRIELDGVDIRDVKLQSLRGHIALVS QDVVLFNDTLAHNIAYGSKREASPDEIRAACVAAHAWDFIQAMPDGLDTLIGENGMRLSG GQRQRIAIARAILKNAPILILDEATSALDSESERHVQAALETLMQNRTTLVIAHRLSTIE RANRIVVLEGGRIVETGAHADLLAKQGRYAQLHALQFSQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | msbA |
Synonyms | msbA; Tbd_2507; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA |
UniProt ID | Q3SFZ6 |
◆ Native Proteins | ||
MB-236B | Native Bovine Myoglobin | +Inquiry |
ACE-3047R | Native rabbit ACE | +Inquiry |
Collagen Type I-61H | Native Human Collagen Type I/III | +Inquiry |
FGA-58R | Native Rabbit Fibrinogen | +Inquiry |
IgG-165R | Native Rabbit IgG Fc fragment | +Inquiry |
◆ Cell & Tissue Lysates | ||
DDX23-7014HCL | Recombinant Human DDX23 293 Cell Lysate | +Inquiry |
SPIRE2-1506HCL | Recombinant Human SPIRE2 293 Cell Lysate | +Inquiry |
GK-5913HCL | Recombinant Human GK 293 Cell Lysate | +Inquiry |
OIP5-3588HCL | Recombinant Human OIP5 293 Cell Lysate | +Inquiry |
GNGT2-5849HCL | Recombinant Human GNGT2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All msbA Products
Required fields are marked with *
My Review for All msbA Products
Required fields are marked with *
0
Inquiry Basket