Recombinant Full Length Pyrenophora Tritici-Repentis Formation Of Crista Junctions Protein 1(Fcj1) Protein, His-Tagged
Cat.No. : | RFL29058PF |
Product Overview : | Recombinant Full Length Pyrenophora tritici-repentis Formation of crista junctions protein 1(FCJ1) Protein (B2WBQ6) (17-641aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pyrenophora tritici-repentis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (17-641) |
Form : | Lyophilized powder |
AA Sequence : | ARAARPQWHVAQRFYVDDKKNLGETAVPNPAPTTQPSSSPSNPTPVQENTIPASEVPKGP PAPDSTIGASRDAPTTQPSTTPPTGTGTASVAPDPIKPLPKKKRRRFRRFLLWLTILSGL GYAGGVWYSLVSDNFHDFFTEYIPYGEDAVAYFEEREFRRRFPGRAGEPRLHPQISGENK VTIPGRSGLTARPAKENSSDLASRGPHVSAVDDNKKQDKTESGGQQPKVSSQTPVAKEQP VQATETASSKAITPLDHLNVPSATEPVVQDVVKIVNDIITVVNADNAHDGKYNSALDKAK SELTKVVSDINAMKETLEQQAEAKVKAAHAEFDQAAKELIQRLDHQMQAQETQFKEEFEN ERERLSQSYKERLQSELQAAQKVYEQSLKNRLLEQSIKMQKSFTATVRERVEAEREGRLG KLNELSSSVHELEKLTAEWNSVVDANLKTQHLVVAVEAVKSALETQVVPKPFVTELAALK EIAADDPVVSAAIASINPAAYQRGIPSSALLIDRFRRVAGEVRKAALLPEDAGMASHLAS LAMSKVLFKKSGLAVGADVEAVLARTEVLLEEGDLDAAAREMNGLQGWAKVLSKDWLSEC RRVLEVKQALDVIATEARLNSLLID |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MIC60 |
Synonyms | MIC60; PTRG_07069; MICOS complex subunit MIC60; Mitofilin |
UniProt ID | B2WBQ6 |
◆ Recombinant Proteins | ||
TNF-2306W | Recombinant Woodchuck TNF protein, His-tagged | +Inquiry |
NFASC-689H | Active Recombinant Human NFASC Protein, His-tagged | +Inquiry |
WDR20-3710H | Recombinant Human WDR20, His-tagged | +Inquiry |
Fem1b-2985M | Recombinant Mouse Fem1b Protein, Myc/DDK-tagged | +Inquiry |
TAF7-16401M | Recombinant Mouse TAF7 Protein | +Inquiry |
◆ Native Proteins | ||
C.Pneumoniae-32 | Native Chlamydia pneumoniae Antigen | +Inquiry |
Hyaluronidase-35O | Active Native Ovine Hyaluronidase, 300U/mg | +Inquiry |
Heartworm-021C | Native Canine Heartworm Antigen | +Inquiry |
Hp1-1-195H | Native Human Haptoglobin 1-1 | +Inquiry |
Hp-134M | Native Mouse Haptoglobin | +Inquiry |
◆ Cell & Tissue Lysates | ||
CREB3-396HCL | Recombinant Human CREB3 cell lysate | +Inquiry |
GABRQ-6055HCL | Recombinant Human GABRQ 293 Cell Lysate | +Inquiry |
TPGS2-8223HCL | Recombinant Human C18orf10 293 Cell Lysate | +Inquiry |
ZKSCAN1-160HCL | Recombinant Human ZKSCAN1 293 Cell Lysate | +Inquiry |
USF1-479HCL | Recombinant Human USF1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All MIC60 Products
Required fields are marked with *
My Review for All MIC60 Products
Required fields are marked with *
0
Inquiry Basket