Recombinant Full Length Arabidopsis Thaliana Probable Mannan Synthase 1(Csla1) Protein, His-Tagged
Cat.No. : | RFL35756AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana Probable mannan synthase 1(CSLA1) Protein (Q84W54) (1-553aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-553) |
Form : | Lyophilized powder |
AA Sequence : | MSLFLKPFLFLYDTTLSLLLLLFNGWSLEDTAAAQKRREADKNAAETEWIQLQYLWTKTR SVVLLPVFKGLVVMCLVLSIIVFFESFYMNFVILFVKLFKRKPHKVYKWEAMQEDVEVGP DNYPMVLIQIPMYNEKEVFQLSIAAICSLVWPSSRLVVQVVDDSTDPAVREGVDVEIAKW QSQGINIRCERRDNRNGYKAGAMKEALTQSYVKQCDFVAVFDADFQPEPDYLIRAVPFLV HNPDVALVQARWIFVNANKCLMTRMQEMSLNYHFKVEQESGSTRHAFFGFNGTAGVWRIS AMEAAGGWKSRTTVEDMDLAVRVGLHGWKFVYLNDLTVRNELPSKFKAYRFQQHRWSCGP ANLFRKMTMEIIFNKRVSIWKKFYVIYSFFFVRKVAVHFLTFFFYCIIVPTSVFFPEIHI PSWSTIYVPSLISIFHTLATPRSFYLVIFWVLFENVMAMHRTKGTCIGLLEGGRVNEWVV TEKLGDALKSKLLSRVVQRKSCYQRVNSKEVMVGVYILGCALYGLIYGHTWLHFYLFLQA TAFFVSGFGFVGT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CSLA1 |
Synonyms | CSLA1; At4g16590; dl4320w; FCAALL.402; Probable glucomannan 4-beta-mannosyltransferase 1; Cellulose synthase-like protein A1; AtCslA1; Glucomannan synthase; Mannan synthase 1 |
UniProt ID | Q84W54 |
◆ Native Proteins | ||
Cp-674M | Native Mouse Ceruloplasmin | +Inquiry |
MPO-01H | Active Native Human MPO Protein | +Inquiry |
CPA-01B | Native Bovine Pancreas Carboxypeptidase A, Type II-PMSF treated | +Inquiry |
GDF15-27680TH | Active Native Human GDF15 Protein | +Inquiry |
A2M-01H | Native Human A2M Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
Amygdala-3H | Human Amygdala Tissue Lysate | +Inquiry |
LTBR-1052RCL | Recombinant Rat LTBR cell lysate | +Inquiry |
AQP6-8766HCL | Recombinant Human AQP6 293 Cell Lysate | +Inquiry |
VAMP1-441HCL | Recombinant Human VAMP1 293 Cell Lysate | +Inquiry |
Temporal Lobe-506C | Cynomolgus monkey Temporal Lobe Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CSLA1 Products
Required fields are marked with *
My Review for All CSLA1 Products
Required fields are marked with *
0
Inquiry Basket