Recombinant Full Length Shewanella Baltica Probable Ubiquinone Biosynthesis Protein Ubib(Ubib) Protein, His-Tagged
Cat.No. : | RFL13542SF |
Product Overview : | Recombinant Full Length Shewanella baltica Probable ubiquinone biosynthesis protein UbiB(ubiB) Protein (A9KYL6) (1-549aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Shewanella baltica |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-549) |
Form : | Lyophilized powder |
AA Sequence : | MTLASIRRGYHVIKTLLQYGLDDVLPPKMTPWYFKLARNSLFWIRNKHKNKPGGERLKLA MQELGPVYIKLGQMLSTRRDLLSDEWASELAMLQDKVPPFDGALARQAIEAELKAPIESL FDDFNETPLASASISQVHTATLKSNGKDVVLKVLRPNVETKIQADLQLMSQTAKLIEYLL GEGNRLRPAEVIEDYRVTILGELNLKLEALNAVKLRNNFLDSDALYVPYVYEEFCYPRLM VMERIYGISVSDIAALKAQGTNFKLLAERGVELFFTQVFRDNFFHADMHPGNIFISRDHP ENPYYIGLDCGIMGTLSEVDKRYLAENFLAFFNRDYHRIAQLYIESGWVSEKTDLQAFEQ AIKVVCEPMFNKPLDEISFGHVLLELFRTARHFDIVVQPQLVLLEKTLLYIEGLGRQLYP QLDLWQTAKPFLEQWMADQVGPKAMFKKVSTKLPYWADKLPEFPELIYDNLKLGRKLLSS QQQMLDKYLKYQQQAHKSNYLLITSAVLLICGTLLINRDATLWTPYVCLVSGIILWFVGW RSRPKNRKF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ubiB |
Synonyms | ubiB; Sbal195_0429; Probable protein kinase UbiB; Ubiquinone biosynthesis protein UbiB |
UniProt ID | A9KYL6 |
◆ Recombinant Proteins | ||
NEUROD4-409H | Recombinant Human NEUROD4 Protein, His-tagged | +Inquiry |
RAD23B-10H | Recombinant Full Length Human RAD23B Protein | +Inquiry |
NECTIN2-692H | Recombinant Human NECTIN2 protein, His-Avi-tagged | +Inquiry |
AGL-2159H | Recombinant Human AGL Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
GM410-6753M | Recombinant Mouse GM410 Protein | +Inquiry |
◆ Native Proteins | ||
C3d-48HB | Native Human Complement C3d Protein, Biotinylated | +Inquiry |
IgA-247G | Native Guinea Pig Immunoglobulin A | +Inquiry |
Plasmin-251H | Active Native Human Plasmin | +Inquiry |
Mb-8232R | Native Rat Myoglobin | +Inquiry |
Lectin-1817P | Active Native Peanut Lectin Protein, Rhodamine labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
DNMT3A-6855HCL | Recombinant Human DNMT3A 293 Cell Lysate | +Inquiry |
BAX-8506HCL | Recombinant Human BAX 293 Cell Lysate | +Inquiry |
SGK3-619HCL | Recombinant Human SGK3 cell lysate | +Inquiry |
APOA1-3088HCL | Recombinant Human APOA1 cell lysate | +Inquiry |
RGS5-2371HCL | Recombinant Human RGS5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All ubiB Products
Required fields are marked with *
My Review for All ubiB Products
Required fields are marked with *
0
Inquiry Basket