Recombinant Full Length Aquifex Aeolicus Apolipoprotein N-Acyltransferase(Lnt) Protein, His-Tagged
Cat.No. : | RFL36439AF |
Product Overview : | Recombinant Full Length Aquifex aeolicus Apolipoprotein N-acyltransferase(lnt) Protein (O67000) (1-439aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Aquifex Aeolicus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-439) |
Form : | Lyophilized powder |
AA Sequence : | MLTDRHKEVLKGLLAGILFYLSFSKLNLYFLVFPALFLGIRKNFLRLFSFGFSAFFLSLL WIRIPLIDYGNINPFIAYPALVLLVLFLSLYQFGLTYLLWRVFKFSFFAFPFLYTLVEIL RSHLPYGGFPWLLLGVNLVDIPVLRYTLNAGTVFLGSFVVLLISLFPLFNKKEKIFSLAI ITPLLIYGFIKETSYRVTHYGLKIALIQPFVPQDVKLNRELFELKYGEIIELVKKAVEKK PDLVVLPESAFPFYLGELEEKGKEILELSKKVPIITGFIEIDEGFKPYNTVVLLKDGRVI EKYRKIKLVPFGEYTPFPFKFFSKYVPYLSFEDYNRGNKVKCFQLNGFSIGTPVCFEVAY PFFVKSFGCEFIAVLTNDAWFRDSEGTFQHMKLARVRAIENEKFFLWVNNTGPSGIISPR GEVIKSIDYGSRGILLFSF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | lnt |
Synonyms | lnt; aq_819; Apolipoprotein N-acyltransferase; ALP N-acyltransferase |
UniProt ID | O67000 |
◆ Recombinant Proteins | ||
ERBB3-68H | Recombinant Human ERBB3 Protein (ECD), His-tagged(C-ter) | +Inquiry |
MUC6-5803M | Recombinant Mouse MUC6 Protein, His (Fc)-Avi-tagged | +Inquiry |
CLEC16A-3550M | Recombinant Mouse CLEC16A Protein | +Inquiry |
MPN372-2622M | Recombinant Mycoplasma Pneumoniae MPN372 Protein (1-202 aa), His-Myc-tagged | +Inquiry |
SIRPA-806H | Active Recombinant Human SIRPA Protein, Fc Chimera | +Inquiry |
◆ Native Proteins | ||
Collagen Type I & III-06M | Native Mouse Collagen Type I and III Protein | +Inquiry |
GAPDH-126R | Active Native Rabbit GAPDH | +Inquiry |
HSP90-110H | Native Human HSP90 | +Inquiry |
WIM-5415B | Native Bovine Vimentin | +Inquiry |
Bladder-023H | Human Bladder Lysate, Total Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MT1X-4097HCL | Recombinant Human MT1X 293 Cell Lysate | +Inquiry |
DNAJC5G-6871HCL | Recombinant Human DNAJC5G 293 Cell Lysate | +Inquiry |
SLCO4A1-1685HCL | Recombinant Human SLCO4A1 293 Cell Lysate | +Inquiry |
DNAJC17-6876HCL | Recombinant Human DNAJC17 293 Cell Lysate | +Inquiry |
ECE2-2052HCL | Recombinant Human ECE2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All lnt Products
Required fields are marked with *
My Review for All lnt Products
Required fields are marked with *
0
Inquiry Basket