Recombinant Full Length Rickettsia Typhi Apolipoprotein N-Acyltransferase(Lnt) Protein, His-Tagged
Cat.No. : | RFL14921RF |
Product Overview : | Recombinant Full Length Rickettsia typhi Apolipoprotein N-acyltransferase(lnt) Protein (Q68X09) (1-496aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rickettsia typhi |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-496) |
Form : | Lyophilized powder |
AA Sequence : | MYKTKIICFLLGILSGLVFAPTFFIPALFTFSYLCYIVQKSQNWQAAAKFGYLFGFGHFL SGMYWISIGVSVYIADFWWAIPFALFGLPIILAFFISTNCTLSFFAKNNKYYQLIFCLLW VLFEWIRSWICTGLPWNLIGYAFSFSEILIQPLSITGIYGLSFIVIYIATSAYPVFSKNF TKLKILLASSMLILTVMVIYGAMRVSTNPTHFTDIKVRLVQPSIPQTAKWDEEEFWHNLM LHINLSEKLEPTDLIIWSEAALVVPDDIPQVKLELLNMLNSTNAILITGGISDNKKHGDK FELYSAMYALDKNNHKLFEYHKSHLVPFGEYMPLKKILPFKKLTHGLIDYKEGNGGLVYI KKYHLKIKPLICYESIFPNFVQTNNEIADVIINITNDSWYGKSSGPYQHFHISRSRAVEN GLPMIRVANNGISAIVDPVGRIVKKLNLNEINYIQGLIPQKLTTPTIFSQFGNFAMLLPI VFILLIHYLLSLIFDD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | lnt |
Synonyms | lnt; RT0354; Apolipoprotein N-acyltransferase; ALP N-acyltransferase |
UniProt ID | Q68X09 |
◆ Recombinant Proteins | ||
COL11A1B-7755Z | Recombinant Zebrafish COL11A1B | +Inquiry |
RNF135-0411H | Recombinant Human RNF135 Protein (A2-V432), His tagged | +Inquiry |
SAOUHSC-02304-3901S | Recombinant Staphylococcus aureus subsp. aureus NCTC 8325 SAOUHSC_02304 protein, His-tagged | +Inquiry |
rne-3422E | Recombinant Escherichia coli (strain K12) rne protein, His-tagged | +Inquiry |
PSMB11-7211M | Recombinant Mouse PSMB11 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
B. garinii-22 | Native Borrelia garinii Antigen | +Inquiry |
COLV-19B | Native Bovine COLV Protein | +Inquiry |
IgG2A-015M | Native Mouse IgG2A Isotype Control, R-Phycoerythrin Conjugated | +Inquiry |
Collagen-315B | Native Bovine Collagen Type III | +Inquiry |
APOC3-361H | Native Human Apolipoprotein C-III | +Inquiry |
◆ Cell & Tissue Lysates | ||
SmallIntestine-497C | Chicken Small Intestine Lysate, Total Protein | +Inquiry |
NFYA-3840HCL | Recombinant Human NFYA 293 Cell Lysate | +Inquiry |
DUPD1-6789HCL | Recombinant Human DUPD1 293 Cell Lysate | +Inquiry |
MAPK11-4496HCL | Recombinant Human MAPK11 293 Cell Lysate | +Inquiry |
GNG3-5852HCL | Recombinant Human GNG3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All lnt Products
Required fields are marked with *
My Review for All lnt Products
Required fields are marked with *
0
Inquiry Basket