Recombinant Full Length Chlorobium Tepidum Apolipoprotein N-Acyltransferase(Lnt) Protein, His-Tagged
Cat.No. : | RFL29354CF |
Product Overview : | Recombinant Full Length Chlorobium tepidum Apolipoprotein N-acyltransferase(lnt) Protein (Q8KCC4) (1-533aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Chlorobium tepidum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-533) |
Form : | Lyophilized powder |
AA Sequence : | MNGAYRGALSRLLSKPFFLPLLSGLLLGISFPTWPAVHLEPLAWIALVPLLLSLEHEERF GPFFRKSWMSMLLFCLIALWWVCLATFVGGILTVFVQSLFSVVPLVVFYYFKKRAGFRSA LLALPFIWTGWEWAYMQQDFSLGWLTFGNSQANLLWMVQYADVTGVWGVSFWLLTFNVLV LLLFMEKESFQVKVGIVMVMLVMIATPLLYARQVFRNTALDNTSPKVRVALVQPDIDPHE KWDGLGPEETLSRLYSLTGQSVRGERLELIIWPETAIPFYIRLPENKPYMDSVRRMVMRW NTPLLTGFPDEVPVFPNSARGEAVAASGAEYAAYNASMLLHPAGGPVQIYRKMRLVPFGE RVPYSEYFPWLERLSFSMSGISSWAKGREATVMHFTSRDGQPVRMANIICYESIFPGQVS TFVRRGAQFLTLVTNDGWYGTSYGPWQHAAIDRLRCIENRRAMARCANTGVTLFYDICGR SYAETPWWQQSVLTADVPLESRITFYTAHPDLVPHVCLGIAGVLALVAAVRKR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | lnt |
Synonyms | lnt; CT1498; Apolipoprotein N-acyltransferase; ALP N-acyltransferase |
UniProt ID | Q8KCC4 |
◆ Recombinant Proteins | ||
TUBA1C-17610M | Recombinant Mouse TUBA1C Protein | +Inquiry |
Cd47-647MAF647 | Recombinant Mouse Cd47 Protein, His-tagged, Alexa Fluor 647 conjugated | +Inquiry |
ART1-3284C | Recombinant Chicken ART1 | +Inquiry |
LGR4-5063M | Recombinant Mouse LGR4 Protein, His (Fc)-Avi-tagged | +Inquiry |
NOVA1-4468C | Recombinant Chicken NOVA1 | +Inquiry |
◆ Native Proteins | ||
IgG-328S | Native Swine Gamma Globulin Fraction | +Inquiry |
IgM-255H | Native Human Rheumatoid Factor IgM | +Inquiry |
TTR-254H | Native Human Prealbumin | +Inquiry |
SUOX-248G | Active Native Chicken Sulfite Oxidase | +Inquiry |
CA2-30H | Native Human Carbonic Anhydrase II (CA2) Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
GCAT-5993HCL | Recombinant Human GCAT 293 Cell Lysate | +Inquiry |
RPS8-568HCL | Recombinant Human RPS8 lysate | +Inquiry |
NPM1-3739HCL | Recombinant Human NPM1 293 Cell Lysate | +Inquiry |
STX8-1030HCL | Recombinant Human STX8 cell lysate | +Inquiry |
EPHA4-1192CCL | Recombinant Cynomolgus EPHA4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All lnt Products
Required fields are marked with *
My Review for All lnt Products
Required fields are marked with *
0
Inquiry Basket