Recombinant Full Length Neisseria Meningitidis Serogroup B Apolipoprotein N-Acyltransferase(Lnt) Protein, His-Tagged
Cat.No. : | RFL2029NF |
Product Overview : | Recombinant Full Length Neisseria meningitidis serogroup B Apolipoprotein N-acyltransferase(lnt) Protein (Q9K0A2) (1-512aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Neisseria Meningitidis Serogroup B |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-512) |
Form : | Lyophilized powder |
AA Sequence : | MVSKLDKYWQHPALYWPLLILFAAATPFTFAPYYHFWLMPLIFGAFVRLIELRPRFAVSS AYLFGLTAYTTQFYWIHTALHDVSGLPDLYAVPLTFLLPAYLALYPALCFWLWKKFTLPR GIKIGLVLPILWTLTEFARERFLTGFGWGAIGYSQITPDSPLAGFAPLGGIHMVTLATAF LGVWLVLASNNTARSGKRLLPIILIAALLAAGYTARQTDFTRPDGSRSTVALLQGNIDQT LKWREDQVIPTIQKYYEQVGKTTADIVILPETAIPVMRQNLPENILAKFAEQAQNNGSAL AVGISQYTSDGNGYENAVINLTGYQENNQDGIPYYAKNHLVPFGEYKPLPFLTTPLYKMM DMPLSDFRKGGGKQSALLMKNQKIAFNICYEDGFGDELIAAAKDATLLANASNMAWYGKS NAMYQHLQQSQARAMELGRYMVRATNTGATAIISPKGNIIAQAQPDTETVLEGHIKGYVG ETPYMKTGSSWWLMGILALAALILFIFRNKEH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | lnt |
Synonyms | lnt; NMB0713; Apolipoprotein N-acyltransferase; ALP N-acyltransferase |
UniProt ID | Q9K0A2 |
◆ Recombinant Proteins | ||
S-73S | Recombinant 2019-nCoV Spike Protein RBD (K417N), His-tagged | +Inquiry |
cxcl12a-1221Z | Recombinant Zebrafish cxcl12a Protein, His&GST-tagged | +Inquiry |
TSLP-01H | Recombinant Human TSLP Protein, 98-159aa, C-His tagged | +Inquiry |
VEGFA-31563TH | Recombinant Human VEGFA | +Inquiry |
SUV39H1-471H | Recombinant Human SUV39H1, GST-tagged | +Inquiry |
◆ Native Proteins | ||
FTH1-28156TH | Native Human FTH1 | +Inquiry |
PRSS1-30745TH | Active Native Human PRSS1 | +Inquiry |
Lectin-1771D | Active Native Dolichos Biflorus Lectin Protein | +Inquiry |
TNNI1-49H | Native Human troponin I type 1 Protein | +Inquiry |
GAPDH-62H | Native Human Glyceraldehyde-3-Phosphate Dehydrogenase (GAPDH) | +Inquiry |
◆ Cell & Tissue Lysates | ||
HIST1H2BB-5542HCL | Recombinant Human HIST1H2BB 293 Cell Lysate | +Inquiry |
RNASE2-1514HCL | Recombinant Human RNASE2 cell lysate | +Inquiry |
ITM2C-5114HCL | Recombinant Human ITM2C 293 Cell Lysate | +Inquiry |
COX4I1-7334HCL | Recombinant Human COX4I1 293 Cell Lysate | +Inquiry |
Bladder-5H | Human Bladder Tissue Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All lnt Products
Required fields are marked with *
My Review for All lnt Products
Required fields are marked with *
0
Inquiry Basket