Recombinant Full Length Vanderwaltozyma Polyspora Formation Of Crista Junctions Protein 1(Fcj1) Protein, His-Tagged
Cat.No. : | RFL31586VF |
Product Overview : | Recombinant Full Length Vanderwaltozyma polyspora Formation of crista junctions protein 1(FCJ1) Protein (A7TSS9) (16-531aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Vanderwaltozyma polyspora |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (16-531) |
Form : | Lyophilized powder |
AA Sequence : | STANNNGATLIKKRHPIRNFILKTALGATVFYAGGVALSEYNEKFAEYFRTYVPLGDDLV HNYEVYRYGPDSKLGEGISVVGLREMIQEVVYRNPTKFHPEGGEIEIIQEVVPPTRLLTL ELITVDDERMDPKFSSLVKDLNSTIETIINQNIYLTDSQIGYILECYSTLTAAVTEYNQQ LQNNMNLIIKEKTTKAVNELNSEYEKKFTDKESELTGKFIQDFNNFKDQLEQKKANELNT ELRANEQTLLAKHANEVALLSITQVEEFTKIIKEKVDKERDGRLGQLQELDASVTSLSKS VDKMNNALMKNEVITQMITLLSSMKQKLNEAGTTNEGLSLEKEIDRIKLLSSIVPLATSS CKCSSKCKSNCKCSKSCGRKKTLMSVGISELDNAASGKLILSNEQLYNRWNLLEGDFKAA SLLPANPGILGHFTAKMFSLLLFTKRGVSVDGTDLDSVYAKVSENIRLSKLDKALADVVS LKGWPHVVCQGWIDDAKRKLEVEALIDVLDSEVRAL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MIC60 |
Synonyms | MIC60; Kpol_282p3; MICOS complex subunit MIC60; Mitofilin |
UniProt ID | A7TSS9 |
◆ Native Proteins | ||
HRP-8336h | Active Native horseradish HRP | +Inquiry |
FN1-3B | Active Bovine Fibronectin, carrier free | +Inquiry |
ALB-5362B | Native Bovine Albumin | +Inquiry |
NEFM-1520B | Native Bovine NEFM | +Inquiry |
PLG -37D | Native Canine plasminogen | +Inquiry |
◆ Cell & Tissue Lysates | ||
JKAMP-5103HCL | Recombinant Human JKAMP 293 Cell Lysate | +Inquiry |
ARMC12-7977HCL | Recombinant Human C6orf81 293 Cell Lysate | +Inquiry |
FNTB-6170HCL | Recombinant Human FNTB 293 Cell Lysate | +Inquiry |
WBP11-1920HCL | Recombinant Human WBP11 cell lysate | +Inquiry |
BPHL-174HCL | Recombinant Human BPHL cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MIC60 Products
Required fields are marked with *
My Review for All MIC60 Products
Required fields are marked with *
0
Inquiry Basket