Recombinant Bovine MDH1 protein, His&Myc-tagged
Cat.No. : | MDH1-5434B |
Product Overview : | Recombinant Bovine MDH1 protein(Q3T145)(2-334aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 2-334a.a. |
Tag : | His&Myc |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 43.8 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | SEPIRVLVTGAAGQIAYSLLYSIGNGSVFGKDQPIILVLLDITPMMGVLDGVLMELQDCALPLLKDVIATDKEEIAFKDLDVAILVGSMPRRDGMERKDLLKANVKIFKCQGAALDKYAKKSVKVIVVGNPANTNCLTASKSAPSIPKENFSCLTRLDHNRAKAQIALKLGVTSDDVKNVIIWGNHSSTQYPDVNHAKVKLQGKEVGVYEALKDDSWLKGEFITTVQQRGAAVIKARKLSSAMSAAKAICDHVRDIWFGTPEGEFVSMGIISDGNSYGIPDDLLYSFPVTIKDKTWKVVEGLPINDFSREKMDLTAKELAEEKETAFEFLASA |
◆ Recombinant Proteins | ||
MDH1-4524H | Recombinant Human MDH1 Protein (Ser2-Ala334), N-GST tagged | +Inquiry |
MDH1-1546H | Recombinant Human MDH1 protein, His & GST-tagged | +Inquiry |
MDH1-29754TH | Recombinant Human MDH1, His-tagged | +Inquiry |
MDH1-6102HF | Recombinant Full Length Human MDH1 Protein, GST-tagged | +Inquiry |
Mdh1-1770R | Recombinant Rat Mdh1 Protein, His&GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MDH1-4409HCL | Recombinant Human MDH1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MDH1 Products
Required fields are marked with *
My Review for All MDH1 Products
Required fields are marked with *
0
Inquiry Basket