Recombinant Human MDH1, His-tagged

• Cat.No.: MDH1-29754TH
• Product Overview: Recombinant full length Human MDH1 with an C terminal His tag; 342 amino acids including tag, predicted MWt 37.4kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 334 amino acids
• Description: Malate dehydrogenase catalyzes the reversible oxidation of malate to oxaloacetate, utilizing the NAD/NADH cofactor system in the citric acid cycle. The protein encoded by this gene is localized to the cytoplasm and may play pivotal roles in the malate-aspartate shuttle that operates in the metabolic coordination between cytosol and mitochondria. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
• Conjugation: HIS
• Molecular Weight: 37.400kDa inclusive of tags
• Form: Liquid
• Purity: >95% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 10% Glycerol, 20mM Tris HCl, pH 8.0
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MSEPIRVLVTGAAGQIAYSLLYSIGNGSVFGKDQPIILVLLDITPMMGVLDGVLMELQDCALPLLKDVIATDKEDVAFKDLDVAILVGSMPRREGMERKDLLKANVKIFKSQGAALDKYAKKSVKVIVVGNPANTNCLTASKSAPSIPKENFSCLTRLDHNRAKAQIALKLGVTANDVKNVIIWGNHSSTQYPDVNHAKVKLQGKEVGVYEALKDDSWLKGEFVTTVQQRGAAVIKARKLSSAMSAAKAICDHVRDIWFGTPEGEFVSMGVISDGNSYGVPDDLLYSFPVVIKNKTWKFVEGLPINDFSREKMDLTAKELTEEKESAFEFLSSALEHHHHHH

Gene Information

• Gene Name: MDH1 malate dehydrogenase 1, NAD (soluble) [ Homo sapiens ]
• Official Symbol: MDH1
• Synonyms: MDH1; malate dehydrogenase 1, NAD (soluble); malate dehydrogenase, cytoplasmic
• Gene ID: 4190
• mRNA Refseq: NM_001199111
• Protein Refseq: NP_001186040
• MIM: 154200
• Uniprot ID: P40925
• Chromosome Location: 2p23
• Pathway: Citrate cycle (TCA cycle), organism-specific biosystem; Citrate cycle (TCA cycle), conserved biosystem; Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate, organism-specific biosystem; Citrate cycle, second carbon oxidation, 2-oxoglutarate =>
• Function: L-malate dehydrogenase activity; NAD binding; malic enzyme activity; oxidoreductase activity