Recombinant Full Length Human MDH1 Protein, GST-tagged

Cat.No. : MDH1-6102HF
Product Overview : Human MDH1 full-length ORF ( AAH01484.1, 1 a.a. - 334 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 334 amino acids
Description : Malate dehydrogenase catalyzes the reversible oxidation of malate to oxaloacetate, utilizing the NAD/NADH cofactor system in the citric acid cycle. The protein encoded by this gene is localized to the cytoplasm and may play pivotal roles in the malate-aspartate shuttle that operates in the metabolic coordination between cytosol and mitochondria. [provided by RefSeq
Molecular Mass : 62.48 kDa
AA Sequence : MSEPIRVLVTGAAGQIAYSLLYSIGNGSVFGKDQPIILVLLDITPMMGVLDGVLMELQDCALPLLKDVIATDKEDVAFKDLDVAILVGSMPRREGMERKDLLKANVKIFKSQGAALDKYAKKSVKVIVVGNPANTNCLTASKSAPSIPKENFSCLTRLDHNRAKAQIALKLGVTANDVKNVIIWGNHSSTQYPDVNHAKVKLQGKEVGVYEALKDDSWLKGEFVTTVQQRGAAVIKARKLSSAMSAAKAICDHVRDIWFGTPEGEFVSMGVISDGNSYGVPDDLLYSFPVVIKNKTWKFVEGLPINDFSREKMDLTAKELTEEKESAFEFLSSA
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MDH1 malate dehydrogenase 1, NAD (soluble) [ Homo sapiens ]
Official Symbol MDH1
Synonyms MDH1; malate dehydrogenase 1, NAD (soluble); malate dehydrogenase, cytoplasmic; soluble malate dehydrogenase; cytosolic malate dehydrogenase; MDHA; MOR2; MDH-s; MGC:1375;
Gene ID 4190
mRNA Refseq NM_001199111
Protein Refseq NP_001186040
MIM 154200
UniProt ID P40925

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All MDH1 Products

Required fields are marked with *

My Review for All MDH1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon