Active Recombinant Mouse Il21 Protein

• Cat.No.: Il21-10M
• Product Overview: Recombinant mouse IL-21 (18-146aa) without tag was expressed in E. coli and purified by using conventional chromatography techniques.

Specification

• Description: Cytokine with immunoregulatory activity. May promote the transition between innate and adaptive immunity. Induces the production of IgG1 and IgG3 in B-cells
• Source: E.coli
• Species: Mouse
• Form: Liquid
• Bio-activity: The activity is determined by the IFN-g ELISA in a using NK-92 human natural killer cells. The ED50 range ≤ 100 ng/mL.
• Molecular Mass: 15 kDa confirmed by MALDI-TOF
• Identity: 130aa
• AA Sequence: MHKSSPQGPDRLLIRLRHLIDIVEQLKIYENDLDPELLSAPQDVKGHCEHAAFACFQKAKLKPSNPGNNKTFIIDLVAQLRRRLPARRGGKKQKHIAKCPSCDSYEKRTPKEFLERLKWLLQKMIHQHLS
• Endotoxin: < 1 EU/μg of protein (determined by LAL method)
• Purity: > 90% by SDS-PAGE
• Applications: SDS-PAGE, Bioactivity
• Storage: Can be stored at 2 to 8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
• Concentration: 1 mg/mL (determined by Bradford assay)
• Storage Buffer: Phosphate-Buffered Saline (pH 7.4)
• Protein length: 18-146 a.a.

Gene Information

• Gene Name: Il21 interleukin 21 [ Mus musculus (house mouse) ]
• Official Symbol: Il21
• Synonyms: Il21; interleukin 21; IL-21; interleukin-21
• Gene ID: 60505
• mRNA Refseq: NM_021782
• Protein Refseq: NP_068554
• UniProt ID: Q9ES17