Active Recombinant Human IL21 Protein (132 aa)

• Cat.No.: IL21-362I
• Product Overview: Recombinant human Interleukin-21 (rhIL-21) produced in E. coli is a single non-glycosylated polypeptide chain containing 132 amino acids. A fully biologically active molecule, rhIL-21 has a molecular mass of 15.4 kDa analyzed by reducing SDS-PAGE and is obtained by proprietary chromatographic techniques.

Specification

• Species: Human
• Source: E.coli
• Protein Length: 132
• Description: Interleukin-21 (IL-21) belongs to the Type I four helix bundle cytokines, and shares the common cytokine receptor γ chain with IL-2, IL-4, IL-7, IL-9, and IL-15. IL-21 is expressed by CD4+ T cells, natural killer (NK) T cells, and Th17 cells, and the IL-21 receptor is highly expressed on CD4+ and CD8+ B cells; indeed, IL-21 plays a pivotal role in the survival and proliferation of B cells, and their differentiation to immunoglobulin (Ig) producing cells. IL-21 up-regulates and down-regulates the production of IgG1 and IgE by B cells, respectively, and diminishes the severity of allergy and asthma. In some case, IL-21 also induces the apoptosis of B cells. The other roles of IL-21 include regulation of innate immune systems, implication on autoimmunity, and antitumor actions.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: ED50 < 0.5 ng/mL, measured by a cell growth inhibition assay using Mino cells, corresponding to a specific activity of > 2.0 × 10^6 units/mg.
• Molecular Mass: 15.4 kDa, observed by reducing SDS-PAGE.
• AA Sequence: MQDRHMIRMRQLIDIVDQLKNYVNDLVPEFLPAPEDVETNCEWSAFSCFQKAQLKSANTGNNERIINVSIKKLKRKPPSTNAGRRQKHRLTCPSCDSYEKKPPKEFLERFKSLLQKMIHQHLSSRTHGSEDS
• Endotoxin: < 0.2 EU/μg, determined by LAL method.
• Purity: > 95% by SDS-PAGE analysis.
• Storage: Lyophilized recombinant human Interleukin-21 (rhIL-21) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rhIL-21 should be stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade.
• Storage Buffer: Lyophilized after extensive dialysis against PBS.
• Reconstitution: Reconstituted in ddH2O at 100 μg/mL.

Gene Information

• Gene Name: IL21 interleukin 21 [ Homo sapiens ]
• Official Symbol: IL21
• Synonyms: IL21; interleukin 21; interleukin-21; IL 21; Za11; interleukin-21 isoform; IL-21
• Gene ID: 59067
• mRNA Refseq: NM_001207006
• Protein Refseq: NP_001193935
• MIM: 605384
• UniProt ID: Q9HBE4