Recombinant Cynomolgus Monkey IL21 Protein
Cat.No. : | IL21-24C |
Product Overview : | Recombinant Cynomolgus Monkey IL21 Protein was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Cynomolgus |
Source : | E.coli |
Description : | This gene encodes a member of the common-gamma chain family of cytokines with immunoregulatory activity. The encoded protein plays a role in both the innate and adaptive immune responses by inducing the differentiation, proliferation and activity of multiple target cells including macrophages, natural killer cells, B cells and cytotoxic T cells. Dysregulation of this gene plays a role in multiple immune-mediated diseases including lupus, psoriasis and chronic inflammatory diseases. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. |
Form : | Liquid. In 1xPBS, pH 7.4. |
Molecular Mass : | ~18.6 kDa |
AA Sequence : | MGWSCIILFLVATATGVHSHHHHHHGGGGSQGQDRHMIRMRQLIDIVDQLKNYVNDLDPEFLPAPEDVETNCEWSAISCFQKAQLKSANTGNNERIINLSIKKLKRKSPSTGAERRQKHRLTCPSCDSYEKKPPKEFLERFKSLLQKMIHQHLSSRTHGSEDS |
Purity : | >90% |
Storage : | Short Term Storage at 4 centigrade, Long Term, please prepare aliquots with 20% glycerol and store at -20 to -80 centigrade. Avoid freeze/thaw cycles. |
Concentration : | 0.75 mg/ml |
Official Full Name : | Interleukin 21 |
Gene Name | IL21 interleukin 21 [ Macaca fascicularis (crab-eating macaque) ] |
Official Symbol | IL21 |
Synonyms | Za11; IL-21; CVID11 |
Gene ID | 102130762 |
mRNA Refseq | XM_005555864 |
Protein Refseq | XP_005555921 |
UniProt ID | A0A2K5VG93 |
◆ Recombinant Proteins | ||
IL21-238B | Recombinant Bovine Interleukin 21 | +Inquiry |
IL21-117H | Recombinant Human IL21 Protein | +Inquiry |
Il21-6742M | Recombinant Mouse Il21 Protein (Pro25-Ser146), N-His tagged | +Inquiry |
Il21-10M | Active Recombinant Mouse Il21 Protein | +Inquiry |
Il21-175M | Recombinant Active Mouse IL21 Protein, His-tagged(C-ter) | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL21-001RCL | Recombinant Rat IL21 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL21 Products
Required fields are marked with *
My Review for All IL21 Products
Required fields are marked with *
0
Inquiry Basket