Recombinant Cynomolgus Monkey IL21 Protein

• Cat.No.: IL21-24C
• Product Overview: Recombinant Cynomolgus Monkey IL21 Protein was expressed in E. coli.

Specification

• Species: Cynomolgus
• Source: E.coli
• Description: This gene encodes a member of the common-gamma chain family of cytokines with immunoregulatory activity. The encoded protein plays a role in both the innate and adaptive immune responses by inducing the differentiation, proliferation and activity of multiple target cells including macrophages, natural killer cells, B cells and cytotoxic T cells. Dysregulation of this gene plays a role in multiple immune-mediated diseases including lupus, psoriasis and chronic inflammatory diseases. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
• Form: Liquid. In 1xPBS, pH 7.4.
• Molecular Mass: ~18.6 kDa
• AA Sequence: MGWSCIILFLVATATGVHSHHHHHHGGGGSQGQDRHMIRMRQLIDIVDQLKNYVNDLDPEFLPAPEDVETNCEWSAISCFQKAQLKSANTGNNERIINLSIKKLKRKSPSTGAERRQKHRLTCPSCDSYEKKPPKEFLERFKSLLQKMIHQHLSSRTHGSEDS
• Purity: >90%
• Storage: Short Term Storage at 4 centigrade, Long Term, please prepare aliquots with 20% glycerol and store at -20 to -80 centigrade. Avoid freeze/thaw cycles.
• Concentration: 0.75 mg/ml
• Official Full Name: Interleukin 21

Gene Information

• Gene Name: IL21 interleukin 21 [ Macaca fascicularis (crab-eating macaque) ]
• Official Symbol: IL21
• Synonyms: Za11; IL-21; CVID11
• Gene ID: 102130762
• mRNA Refseq: XM_005555864
• Protein Refseq: XP_005555921
• UniProt ID: A0A2K5VG93