Active Recombinant Mouse IL21 Protein
Cat.No. : | IL21-162M |
Product Overview : | Recombinant Mouse IL21 Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Description : | Interleukin 21 (IL-21) is a member of the common-gamma chain family of cytokines that are involved in immunoregulation. IL-21 is normally expressed by activated CD4+ T cells and is aberrantly expressed in Hodgkin lymphoma cells. The IL-21 receptor (IL-21R) activates the JAK/STAT signaling pathway and is expressed on T, B, and natural killer (NK) cells. Within the B cell lineage, IL-21 is a switch factor regulating IgG1 and IgG3 antibody production. IL-21 also cooperates with IL-4 for the production of multiple antibody classes in B cells. IL-21 has pleiotropic effects on the proliferation, differentiation, and effector functions of B, T, NK, and dendritic cells. |
Bio-activity : | B9 cell proliferation, ED50≤50 ng/mL |
AA Sequence : | MQDRHMIRMRQLIDIVDQLKNYVNDLVPEFLPAPEDVETNCEWSAFSCFQKAQLKSANTGNNERIINVSIKKLKRKPPSTNAGRRQKHRLTCPSCDSYEKKPPKEFLERFKSLLQKMIHQHLSSRTHGSEDS |
Endotoxin : | ≤1 EUs/μg, Kinetic LAL |
Purity : | ≥95%, Reducing and Non-Reducing SDS PAGE |
Stability : | 12 months from date of receipt when stored at -20 to -80 centigrade as supplied. 1 month when stored at 4 centigrade after reconstituting as directed. 3 months when stored at -20 to -80 centigrade after reconstituting as directed. |
Storage : | Storage Prior to Reconstitution: |
Storage Buffer : | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, pH 7.5 |
Reconstitution : | Sterile water at 0.1 mg/mL |
Shipping : | Room temperature |
Gene Name | Il21 interleukin 21 [ Mus musculus (house mouse) ] |
Official Symbol | IL21 |
Synonyms | IL21; interleukin 21; interleukin-21; IL-21; |
Gene ID | 60505 |
mRNA Refseq | NM_021782 |
Protein Refseq | NP_068554 |
UniProt ID | Q9ES17 |
◆ Recombinant Proteins | ||
IL21-2122H | Active Recombinant Human IL21 protein | +Inquiry |
IL21-7872HFL | Recombinant Full Length Human IL21 protein, Flag-tagged | +Inquiry |
Il21-6742M | Recombinant Mouse Il21 Protein (Pro25-Ser146), N-His tagged | +Inquiry |
IL21-298H | Recombinant Human IL21 protein, Fc-tagged | +Inquiry |
IL21-047H | Recombinant Human interleukin 21 Protein, His&Flag tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL21-001RCL | Recombinant Rat IL21 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL21 Products
Required fields are marked with *
My Review for All IL21 Products
Required fields are marked with *
0
Inquiry Basket