Recombinant Human LTA Protein, His/Flag/StrepII-tagged
Cat.No. : | LTA-4599H |
Product Overview : | Purified LTA (AAH34729.1 58 a.a. - 205 a.a.) human recombinant protein with His-Flag-StrepII tag at N-terminus expressed in human cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Human Cells |
Tag : | Flag&His&Strep II |
Protein Length : | 58-205 a.a. |
Description : | The encoded protein, a member of the tumor necrosis factor family, is a cytokine produced by lymphocytes. The protein is highly inducible, secreted, and forms heterotrimers with lymphotoxin-beta which anchor lymphotoxin-alpha to the cell surface. This protein also mediates a large variety of inflammatory, immunostimulatory, and antiviral responses, is involved in the formation of secondary lymphoid organs during development and plays a role in apoptosis. Genetic variations in this gene are associated with susceptibility to leprosy type 4 and psoriatic arthritis |
Form : | Liquid |
Bio-activity : | Not Tested |
Molecular Mass : | 21.56 kDa |
AA Sequence : | HSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL |
Applications : | Western Blot Enzyme-linked Immunoabsorbent Assay SDS-PAGE Protein Interaction |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Concentration : | ≥ 10 μg/mL |
Storage Buffer : | 100 mM Tris-HCl pH 8.0, 150 mM NaCl, 1 mM EDTA, and 5 mM desthiobiotin. |
Gene Name | LTA lymphotoxin alpha (TNF superfamily, member 1) [ Homo sapiens ] |
Official Symbol | LTA |
Synonyms | LTA; lymphotoxin alpha (TNF superfamily, member 1); TNFB; lymphotoxin-alpha; LT; TNFSF1; LT-alpha; TNF-beta; tumor necrosis factor beta; tumor necrosis factor ligand superfamily member 1; |
Gene ID | 4049 |
mRNA Refseq | NM_000595 |
Protein Refseq | NP_000586 |
MIM | 153440 |
UniProt ID | P01374 |
◆ Recombinant Proteins | ||
LTA-9342M | Recombinant Mouse LTA Protein | +Inquiry |
LTA-6059HF | Recombinant Full Length Human LTA Protein, GST-tagged | +Inquiry |
LTA-31534TH | Recombinant Human LTA, His-tagged | +Inquiry |
LTA-5068H | Recombinant Human Lymphotoxin Alpha (TNF superfamily, member 2), His-tagged | +Inquiry |
LTA-31536TH | Recombinant Human LTA, His-tagged | +Inquiry |
◆ Native Proteins | ||
LTA-18S | Native S. aureus LTA Protein | +Inquiry |
LTA-15B | Native Bacillus subtilis LTA Protein | +Inquiry |
LTA-14S | Native S. aureus LTA Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
LTA-9167HCL | Recombinant Human LTA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LTA Products
Required fields are marked with *
My Review for All LTA Products
Required fields are marked with *
0
Inquiry Basket