Recombinant Full Length Human LTA Protein, GST-tagged
Cat.No. : | LTA-6059HF |
Product Overview : | Human LTA full-length ORF ( AAH34729, 1 a.a. - 205 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 205 amino acids |
Description : | The encoded protein, a member of the tumor necrosis factor family, is a cytokine produced by lymphocytes. The protein is highly inducible, secreted, and forms heterotrimers with lymphotoxin-beta which anchor lymphotoxin-alpha to the cell surface. This protein also mediates a large variety of inflammatory, immunostimulatory, and antiviral responses, is involved in the formation of secondary lymphoid organs during development and plays a role in apoptosis. Genetic variations in this gene are associated with susceptibility to leprosy type 4 and psoriatic arthritis |
Molecular Mass : | 48.29 kDa |
AA Sequence : | MTPPERLFLPRVRGTTLHLLLLGLLLVLLPGAQGLPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | LTA lymphotoxin alpha (TNF superfamily, member 1) [ Homo sapiens ] |
Official Symbol | LTA |
Synonyms | LTA; lymphotoxin alpha (TNF superfamily, member 1); TNFB; lymphotoxin-alpha; LT; TNFSF1; LT-alpha; TNF-beta; tumor necrosis factor beta; tumor necrosis factor ligand superfamily member 1; |
Gene ID | 4049 |
mRNA Refseq | NM_000595 |
Protein Refseq | NP_000586 |
MIM | 153440 |
UniProt ID | P01374 |
◆ Native Proteins | ||
LTA-15B | Native Bacillus subtilis LTA Protein | +Inquiry |
LTA-18S | Native S. aureus LTA Protein | +Inquiry |
LTA-14S | Native S. aureus LTA Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
LTA-9167HCL | Recombinant Human LTA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LTA Products
Required fields are marked with *
My Review for All LTA Products
Required fields are marked with *
0
Inquiry Basket