Recombinant Rhesus macaque OSM protein, His-tagged
Cat.No. : | OSM-563R |
Product Overview : | Recombinant Rhesus macaque OSM protein(F7GF43)(1-231aa), fused with N-terminal His tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rhesus macaque |
Source : | HEK293 |
Tag : | His |
Protein Length : | 1-231aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 29.9 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | MASMAAMGSCSKEYRMLLGQLQKQTDLMQDTSRLLDPYIRIQGLDIPKLREHCRESPGAFPSEETLRGLGRRGFLQTLNATLGRVLHRLADLEQHLPKAQDLERSGLNIEDLEKLQMARPNVLGLRNNVYCMAQLLDNSDMTEPTKAGRGTPQPPTPTPTSDVFQRKLEGCSFLRGYHRFMHSVGRVFSKWGESPNRSRRHSPHQALRKGVRRTRPSRKGNRLMPRGQLPR |
◆ Recombinant Proteins | ||
OSM-1589H | Recombinant Human OSM Protein, His (Fc)-Avi-tagged | +Inquiry |
OSM-43H | Active Recombinant Human OSM Protein, Animal Free | +Inquiry |
Osm-319O | Active Recombinant Rat Osm Protein (215 aa) | +Inquiry |
Osm-4527R | Recombinant Rat Osm protein, His-tagged | +Inquiry |
Osm-1771M | Recombinant Mouse Oncostatin M | +Inquiry |
◆ Native Proteins | ||
Osm-3256R | Recombinant Rhesus Monkey OSM Protein, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
OSM-1766HCL | Recombinant Human OSM cell lysate | +Inquiry |
OSM-1659MCL | Recombinant Mouse OSM cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All OSM Products
Required fields are marked with *
My Review for All OSM Products
Required fields are marked with *
0
Inquiry Basket