Active Recombinant Rat Osm Protein (215 aa)
Cat.No. : | Osm-319O |
Product Overview : | Recombinant Rat Oncostatin M (rrOSM) produced in E. coli is a single non-glycosylated polypeptide chain containing 215 amino acids. A fully biologically active molecule, rrOSM has a molecular mass of 24.5 kDa analyzed by reducing SDS-PAGE and is obtained by proprietary chromatographic techniques. |
- Specification
- Gene Information
- Related Products
- Download
Description : | Oncostatin M (OSM) is a multifunctional cytokine, and belongs to Interleukin-6 (IL-6) subfamily, which also includes IL-11, leukemia inhibitory factor (LIF), ciliary neurotropic factor, cardiotrophin-1, and novel neurotropin-1. In vivo, OSM is secreted from activated T cells, monocytes, neutrophils, and endothelial cells. OSM is related to LIF, and shares a receptor with LIF in human. Human OSM can bind to gp130 and recruit OSM Receptor β or LIF Receptor β to form a ternary complex. OSM stimulates the growth of different types of cells, including megakaryocytes, fibroblasts, vascular endothelial cells, and T cells. OSM inhibits the proliferation of several cancer cell lines, such as solid tissue tumor cells, lung cancer cells, melanoma cells, and breast cancer cells. |
Source : | E. coli |
Species : | Rat |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | ED50 < 10 ng/mL, measured by a cell proliferation assay using Rat Embryo Brain cells, corresponding to a specific activity of > 1 × 10^5 units/mg. |
Molecular Mass : | 24.5 kDa, observed by reducing SDS-PAGE. |
Protein length : | 215 |
AA Sequence : | MKRGCSSSSPKLLSQLKSQANITGNTASLLEPYILHQNLNTLTLRAACTEHPVAFPSEDMLRQLSKPDFLSTVHATLGRVWHQLGAFRQQFPKIQDFPELERARQNIQGIRNNVYCMARLLHPPLEIPEPTQADSGTSRPTTTAPGIFQIKIDSCRFLWGYHRFMGSVGRVFEEWGDGSRRSRRHSPLWAWLKGDHRIRPSRSSQSAMLRSLVPR |
Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
Purity : | > 95% as analyzed by SDS-PAGE and HPLC. |
Storage : | Lyophilized recombinant Rat Oncostatin M (rrOSM) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rrOSM remains stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade. |
Storage Buffer : | Lyophilized after extensive dialysis against PBS. |
Reconstitution : | Reconstituted in ddH2O or PBS at 100 μg/mL. |
Gene Name | Osm oncostatin M [ Rattus norvegicus ] |
Official Symbol | Osm |
Synonyms | OSM; oncostatin M; |
Gene ID | 289747 |
mRNA Refseq | NM_001006961 |
Protein Refseq | NP_001006962 |
UniProt ID | Q65Z15 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All Osm Products
Required fields are marked with *
My Review for All Osm Products
Required fields are marked with *
0
Inquiry Basket