Recombinant Rat Sult1a1 Protein, His-SUMO/MYC-tagged
Cat.No. : | Sult1a1-1379R |
Product Overview : | Recombinant Rat Sult1a1 Protein (1-291aa) was expressed in E. coli with N-terminal His-SUMO and C-terminal MYC tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His&Myc&SUMO |
ProteinLength : | 1-291 a.a. |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 53.9 kDa |
AA Sequence : | MEFSRPPLVHVKGIPLIKYFAETIGPLQNFTAWPDDLLISTYPKSGTTWMSEILDMIYQGGKLEKCGRAPIYARVPFLEFKCPGVPSGLETLEETPAPRLLKTHLPLSLLPQSLLDQKVKVIYIARNAKDVVVSYYNFYNMAKLHPDPGTWDSFLENFMDGEVSYGSWYQHVKEWWELRHTHPVLYLFYEDIKENPKREIKKILEFLGRSLPEETVDSIVHHTSFKKMKENCMTNYTTIPTEIMDHNVSPFMRKGTTGDWKNTFTVAQNERFDAHYAKTMTDCDFKFRCEL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name | Sult1a1 sulfotransferase family 1A member 1 [ Rattus norvegicus (Norway rat) ] |
Official Symbol | Sult1a1 |
Synonyms | Stm; Stp1; ASTIV; Mx-ST; PST-1; St1a1; Sult1a3; EC 2.8.2.1 |
Gene ID | 83783 |
mRNA Refseq | NM_031834.1 |
Protein Refseq | NP_114022.1 |
UniProt ID | P17988 |
◆ Recombinant Proteins | ||
B4GALT1-646H | Active Recombinant Human B4GALT1 protein, His-tagged | +Inquiry |
ANG-1424H | Recombinant Human ANG Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CBR1-817R | Recombinant Rat CBR1 Protein, His (Fc)-Avi-tagged | +Inquiry |
GRPEL1-301516H | Recombinant Human GRPEL1 protein, GST-tagged | +Inquiry |
ENO-563A | Recombinant Alternaria alternata ENO protein | +Inquiry |
◆ Native Proteins | ||
Avidin-014 | Native Avidin Protein, Gold conjugated | +Inquiry |
APOA2-5302H | Native Human Apolipoprotein A-II | +Inquiry |
MPO-01H | Active Native Human MPO Protein | +Inquiry |
IgA-302H | Native Human Immunoglobulin A | +Inquiry |
Apotransferrin-36M | Native Mouse Apotransferrin | +Inquiry |
◆ Cell & Tissue Lysates | ||
FABP1-6479HCL | Recombinant Human FABP1 293 Cell Lysate | +Inquiry |
MGST1-1110HCL | Recombinant Human MGST1 cell lysate | +Inquiry |
IMPDH1-5211HCL | Recombinant Human IMPDH1 293 Cell Lysate | +Inquiry |
FAM169B-650HCL | Recombinant Human FAM169B cell lysate | +Inquiry |
NDUFA4-3919HCL | Recombinant Human NDUFA4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Sult1a1 Products
Required fields are marked with *
My Review for All Sult1a1 Products
Required fields are marked with *
0
Inquiry Basket