Recombinant Human GRPEL1 protein, GST-tagged
Cat.No. : | GRPEL1-301516H |
Product Overview : | Recombinant Human GRPEL1 (1-217 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Met1-Ala217 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | MAAQCVRLARRSLPALALSLRPSPRLLCTATKQKNSGQNLEEDMGQSEQKADPPATEKTLLEEKVKLEEQLKETVEKYKRALADTENLRQRSQKLVEEAKLYGIQAFCKDLLEVADVLEKATQCVPKEEIKDDNPHLKNLYEGLVMTEVQIQKVFTKHGLLKLNPVGAKFDPYEHEALFHTPVEGKEPGTVALVSKVGYKLHGRTLRPALVGVVKEA |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | GRPEL1 GrpE-like 1, mitochondrial (E. coli) [ Homo sapiens ] |
Official Symbol | GRPEL1 |
Synonyms | GRPEL1; GrpE-like 1, mitochondrial (E. coli); grpE protein homolog 1, mitochondrial; FLJ25609; HMGE; mt-GrpE#1; GrpE-like protein cochaperone; |
Gene ID | 80273 |
mRNA Refseq | NM_025196 |
Protein Refseq | NP_079472 |
MIM | 606173 |
UniProt ID | Q9HAV7 |
◆ Recombinant Proteins | ||
GRPEL1-1979R | Recombinant Rhesus monkey GRPEL1 Protein, His-tagged | +Inquiry |
GRPEL1-301516H | Recombinant Human GRPEL1 protein, GST-tagged | +Inquiry |
GRPEL1-5604HF | Recombinant Full Length Human GRPEL1 Protein, GST-tagged | +Inquiry |
GRPEL1-568C | Recombinant Cynomolgus GRPEL1 Protein, His-tagged | +Inquiry |
GRPEL1-1597C | Recombinant Chicken GRPEL1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
GRPEL1-754HCL | Recombinant Human GRPEL1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GRPEL1 Products
Required fields are marked with *
My Review for All GRPEL1 Products
Required fields are marked with *
0
Inquiry Basket