Active Recombinant Mouse Osm Protein

• Cat.No.: Osm-168O
• Product Overview: Recombinant Mouse Osm Protein without tag was expressed in HEK 293.

Specification

• Species: Mouse
• Source: HEK293
• Description: Oncostatin-M, also known as OSM, is a growth regulator belonging to the interleukin-6 group of cytokines. It is expressed mainly by monocytes, activated T cells and Kaposi’s sarcoma cells. OSM signals through two types of receptors; one is composed of gp130 and LIFR, and the other is composed of gp130 and OSMR. OSM regulates IL-6, G-CSF and GM-CSF production, and thus is involved in hematopoiesis, neurogenesis and osteogenesis. OSM displays both stimulatory and inhibitory effects, so its categorization as pro-inflammatory or anti-inflammatory cytokine is still controversial.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: ED50 < 0.4 ng/mL, measured in a cell proliferation assay using NIH-3T3 cells.
• Molecular Mass: 10-40 kDa, observed by reducing SDS-PAGE.
• AA Sequence: ANRGCSNSSSQLLSQLQNQANLTGNTESLLEPYIRLQNLNTPDLRAACTQHSVAFPSEDTLRQLSKPHFLSTVYTTLDRVLYQLDALRQKFLKTPAFPKLDSARHNILGIRNNVFCMARLLNHSLEIPEPTQTDSGASRSTTTPDVFNTKIGSCGFLWGYHRFMGSVGRVFREWDDGSTRSRR
• Endotoxin: < 0.2 EU/μg, determined by LAL method.
• Purity: > 95% as analyzed by SDS-PAGE and HPLC.
• Storage: Lyophilized recombinant Murine Oncostatin-M remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Murine Oncostatin-M should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade.
• Storage Buffer: Lyophilized after extensive dialysis against PBS.
• Reconstitution: Reconstituted in ddH2O or PBS at 100 μg/mL.

Gene Information

• Gene Name: Osm oncostatin M [ Mus musculus ]
• Official Symbol: Osm
• Synonyms: OSM; oncostatin M; oncostatin-M; OncoM
• Gene ID: 18413
• mRNA Refseq: NM_001013365
• Protein Refseq: NP_001013383
• UniProt ID: P53347